Canis lupus familiaris (dog): 403782 Help Entry 403782            CDS       T01007                                  Symbol IL1A Name (RefSeq) interleukin-1 alpha   KO K04383   interleukin 1 alpha Organism cfa  Canis lupus familiaris (dog) Pathway cfa04010   MAPK signaling pathway cfa04060   Cytokine-cytokine receptor interaction cfa04217   Necroptosis cfa04218   Cellular senescence cfa04380   Osteoclast differentiation cfa04640   Hematopoietic cell lineage cfa04932   Non-alcoholic fatty liver disease cfa04933   AGE-RAGE signaling pathway in diabetic complications cfa04940   Type I diabetes mellitus cfa05010   Alzheimer disease cfa05020   Prion disease cfa05022   Pathways of neurodegeneration - multiple diseases cfa05133   Pertussis cfa05140   Leishmaniasis cfa05152   Tuberculosis cfa05162   Measles cfa05164   Influenza A cfa05321   Inflammatory bowel disease cfa05323   Rheumatoid arthritis cfa05332   Graft-versus-host disease cfa05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cfa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     403782 (IL1A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     403782 (IL1A)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     403782 (IL1A)    04218 Cellular senescence     403782 (IL1A)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     403782 (IL1A)   09158 Development and regeneration    04380 Osteoclast differentiation     403782 (IL1A)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     403782 (IL1A)    05162 Measles     403782 (IL1A)   09171 Infectious disease: bacterial    05133 Pertussis     403782 (IL1A)    05152 Tuberculosis     403782 (IL1A)   09174 Infectious disease: parasitic    05140 Leishmaniasis     403782 (IL1A)   09163 Immune disease    05323 Rheumatoid arthritis     403782 (IL1A)    05321 Inflammatory bowel disease     403782 (IL1A)    05332 Graft-versus-host disease     403782 (IL1A)   09164 Neurodegenerative disease    05010 Alzheimer disease     403782 (IL1A)    05020 Prion disease     403782 (IL1A)    05022 Pathways of neurodegeneration - multiple diseases     403782 (IL1A)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     403782 (IL1A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     403782 (IL1A)    04932 Non-alcoholic fatty liver disease     403782 (IL1A)    04933 AGE-RAGE signaling pathway in diabetic complications     403782 (IL1A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cfa04052]     403782 (IL1A) Cytokines and neuropeptides [BR:cfa04052]  Cytokines   Interleukins    403782 (IL1A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL1 IL1_propep DUF3958 Motif Other DBs NCBI-GeneID:  403782 NCBI-ProteinID:  NP_001003157 Ensembl:  ENSCAFG00000007245 VGNC:  41956 UniProt:  O46612 A0A8C0SHI9 A0A8I3NDD2 LinkDB All DBs Position 17:complement(36739697..36748565) Genome browser AA seq 265 aa AA seqDB search MAKVPDLFEDLKNCYSENEEYSSEIDHLSLNQKSFYDMSCDPLHEDCMSLSTSEISKTSQ LTFKENVVVVAANGKILKKRRLSLSQFITDDDLEDIANDTEEVIMKPRSVAYNFHNNEKY NYIRIIKSQFILNDNLNQSIVRQTGGNYLMTAALQNLDDAVKFDMGAYTSEDSKLPVTLR ISKTRLFVSAQNEDEPVLLKEMPETPKTIRDETNLLFFWERHGSKHYFKSVAQPKLFIAT QERKLVHMARGQPSITDFRLLETQP NT seq 798 nt NT seq  +upstreamnt  +downstreamnt atggccaaagttcctgacctctttgaagacctgaagaactgttacagtgaaaatgaagaa tacagttctgaaattgaccatctctctctgaatcagaaatccttctatgatatgagctgt gacccacttcatgaggactgcatgtctctgagtacctctgaaatctcaaagacatcccag cttaccttcaaggaaaatgtggtagtggtggcagccaatgggaagattctaaagaagaga cggttgagtttaagtcaattcatcaccgatgatgacctggaagacattgccaatgacaca gaagaagtaatcatgaagcccagatcagtagcatacaacttccataacaatgaaaaatac aactatataaggatcatcaaatcccaattcatcctgaatgacaacctcaatcaaagtata gttcgacaaacaggaggaaattacctcatgactgctgcattacagaatttggatgatgca gtgaagtttgacatgggagcttacacatcagaagattctaaacttcctgtgactctaaga atatcaaaaactcgactctttgtgagtgcccaaaatgaagatgaacctgtattgctaaag gagatgcctgagacacccaaaactatcagagatgagacaaaccttcttttcttttgggag cgtcatggcagtaagcactacttcaaatcagttgcccagcccaagttgttcattgccaca caggaacgaaaactggtgcacatggcaagagggcaaccctctatcactgactttcggtta ctggaaacccagccttga

DBGET integrated database retrieval system