Canis lupus familiaris (dog): 403800 Help Entry 403800            CDS       T01007                                  Symbol MT1E Name (RefSeq) metallothionein-1   KO K14739   metallothionein 1/2 Organism cfa  Canis lupus familiaris (dog) Pathway cfa04978   Mineral absorption Brite KEGG Orthology (KO) [BR:cfa00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     403800 (MT1E)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:cfa03019]     403800 (MT1E)    03029 Mitochondrial biogenesis [BR:cfa03029]     403800 (MT1E) Messenger RNA biogenesis [BR:cfa03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      403800 (MT1E) Mitochondrial biogenesis [BR:cfa03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     403800 (MT1E) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  403800 NCBI-ProteinID:  NP_001003173 Ensembl:  ENSCAFG00000009110 UniProt:  O19000 LinkDB All DBs Position 2:complement(56236212..56237865) Genome browser AA seq 61 aa AA seqDB search MDPDCSCSTGGSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccgactgctcctgctccaccggtggctcctgcacgtgcgctggctcctgcaaa tgcaaggagtgcaaatgcacctcctgcaagaagagttgctgctcctgctgccccgtgggc tgtgccaagtgtgcccagggctgcatctgcaagggtgcgtcggacaagtgcagctgctgt gcctga

DBGET integrated database retrieval system