KEGG   Canis lupus familiaris (dog): 403872
Entry
403872            CDS       T01007                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa01521  EGFR tyrosine kinase inhibitor resistance
cfa01522  Endocrine resistance
cfa04010  MAPK signaling pathway
cfa04012  ErbB signaling pathway
cfa04014  Ras signaling pathway
cfa04015  Rap1 signaling pathway
cfa04062  Chemokine signaling pathway
cfa04068  FoxO signaling pathway
cfa04071  Sphingolipid signaling pathway
cfa04072  Phospholipase D signaling pathway
cfa04137  Mitophagy - animal
cfa04140  Autophagy - animal
cfa04150  mTOR signaling pathway
cfa04151  PI3K-Akt signaling pathway
cfa04210  Apoptosis
cfa04211  Longevity regulating pathway
cfa04213  Longevity regulating pathway - multiple species
cfa04218  Cellular senescence
cfa04360  Axon guidance
cfa04370  VEGF signaling pathway
cfa04371  Apelin signaling pathway
cfa04540  Gap junction
cfa04550  Signaling pathways regulating pluripotency of stem cells
cfa04625  C-type lectin receptor signaling pathway
cfa04650  Natural killer cell mediated cytotoxicity
cfa04660  T cell receptor signaling pathway
cfa04662  B cell receptor signaling pathway
cfa04664  Fc epsilon RI signaling pathway
cfa04714  Thermogenesis
cfa04720  Long-term potentiation
cfa04722  Neurotrophin signaling pathway
cfa04725  Cholinergic synapse
cfa04726  Serotonergic synapse
cfa04730  Long-term depression
cfa04810  Regulation of actin cytoskeleton
cfa04910  Insulin signaling pathway
cfa04912  GnRH signaling pathway
cfa04915  Estrogen signaling pathway
cfa04916  Melanogenesis
cfa04917  Prolactin signaling pathway
cfa04919  Thyroid hormone signaling pathway
cfa04921  Oxytocin signaling pathway
cfa04926  Relaxin signaling pathway
cfa04929  GnRH secretion
cfa04933  AGE-RAGE signaling pathway in diabetic complications
cfa04935  Growth hormone synthesis, secretion and action
cfa05010  Alzheimer disease
cfa05022  Pathways of neurodegeneration - multiple diseases
cfa05034  Alcoholism
cfa05160  Hepatitis C
cfa05161  Hepatitis B
cfa05163  Human cytomegalovirus infection
cfa05165  Human papillomavirus infection
cfa05166  Human T-cell leukemia virus 1 infection
cfa05167  Kaposi sarcoma-associated herpesvirus infection
cfa05170  Human immunodeficiency virus 1 infection
cfa05200  Pathways in cancer
cfa05203  Viral carcinogenesis
cfa05205  Proteoglycans in cancer
cfa05206  MicroRNAs in cancer
cfa05207  Chemical carcinogenesis - receptor activation
cfa05208  Chemical carcinogenesis - reactive oxygen species
cfa05210  Colorectal cancer
cfa05211  Renal cell carcinoma
cfa05213  Endometrial cancer
cfa05214  Glioma
cfa05215  Prostate cancer
cfa05216  Thyroid cancer
cfa05218  Melanoma
cfa05219  Bladder cancer
cfa05220  Chronic myeloid leukemia
cfa05221  Acute myeloid leukemia
cfa05223  Non-small cell lung cancer
cfa05224  Breast cancer
cfa05225  Hepatocellular carcinoma
cfa05226  Gastric cancer
cfa05230  Central carbon metabolism in cancer
cfa05231  Choline metabolism in cancer
cfa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cfa05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    403872 (NRAS)
   04012 ErbB signaling pathway
    403872 (NRAS)
   04014 Ras signaling pathway
    403872 (NRAS)
   04015 Rap1 signaling pathway
    403872 (NRAS)
   04370 VEGF signaling pathway
    403872 (NRAS)
   04371 Apelin signaling pathway
    403872 (NRAS)
   04068 FoxO signaling pathway
    403872 (NRAS)
   04072 Phospholipase D signaling pathway
    403872 (NRAS)
   04071 Sphingolipid signaling pathway
    403872 (NRAS)
   04151 PI3K-Akt signaling pathway
    403872 (NRAS)
   04150 mTOR signaling pathway
    403872 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    403872 (NRAS)
   04137 Mitophagy - animal
    403872 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    403872 (NRAS)
   04218 Cellular senescence
    403872 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    403872 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    403872 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    403872 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    403872 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    403872 (NRAS)
   04660 T cell receptor signaling pathway
    403872 (NRAS)
   04662 B cell receptor signaling pathway
    403872 (NRAS)
   04664 Fc epsilon RI signaling pathway
    403872 (NRAS)
   04062 Chemokine signaling pathway
    403872 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    403872 (NRAS)
   04929 GnRH secretion
    403872 (NRAS)
   04912 GnRH signaling pathway
    403872 (NRAS)
   04915 Estrogen signaling pathway
    403872 (NRAS)
   04917 Prolactin signaling pathway
    403872 (NRAS)
   04921 Oxytocin signaling pathway
    403872 (NRAS)
   04926 Relaxin signaling pathway
    403872 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    403872 (NRAS)
   04919 Thyroid hormone signaling pathway
    403872 (NRAS)
   04916 Melanogenesis
    403872 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    403872 (NRAS)
   04726 Serotonergic synapse
    403872 (NRAS)
   04720 Long-term potentiation
    403872 (NRAS)
   04730 Long-term depression
    403872 (NRAS)
   04722 Neurotrophin signaling pathway
    403872 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    403872 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    403872 (NRAS)
   04213 Longevity regulating pathway - multiple species
    403872 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    403872 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    403872 (NRAS)
   05206 MicroRNAs in cancer
    403872 (NRAS)
   05205 Proteoglycans in cancer
    403872 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    403872 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    403872 (NRAS)
   05203 Viral carcinogenesis
    403872 (NRAS)
   05230 Central carbon metabolism in cancer
    403872 (NRAS)
   05231 Choline metabolism in cancer
    403872 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    403872 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    403872 (NRAS)
   05225 Hepatocellular carcinoma
    403872 (NRAS)
   05226 Gastric cancer
    403872 (NRAS)
   05214 Glioma
    403872 (NRAS)
   05216 Thyroid cancer
    403872 (NRAS)
   05221 Acute myeloid leukemia
    403872 (NRAS)
   05220 Chronic myeloid leukemia
    403872 (NRAS)
   05218 Melanoma
    403872 (NRAS)
   05211 Renal cell carcinoma
    403872 (NRAS)
   05219 Bladder cancer
    403872 (NRAS)
   05215 Prostate cancer
    403872 (NRAS)
   05213 Endometrial cancer
    403872 (NRAS)
   05224 Breast cancer
    403872 (NRAS)
   05223 Non-small cell lung cancer
    403872 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    403872 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    403872 (NRAS)
   05161 Hepatitis B
    403872 (NRAS)
   05160 Hepatitis C
    403872 (NRAS)
   05163 Human cytomegalovirus infection
    403872 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    403872 (NRAS)
   05165 Human papillomavirus infection
    403872 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    403872 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    403872 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    403872 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    403872 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    403872 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    403872 (NRAS)
   01522 Endocrine resistance
    403872 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfa04131]
    403872 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    403872 (NRAS)
   04031 GTP-binding proteins [BR:cfa04031]
    403872 (NRAS)
Membrane trafficking [BR:cfa04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    403872 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    403872 (NRAS)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   403872 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   403872 (NRAS)
  Exosomal proteins of breast cancer cells
   403872 (NRAS)
  Exosomal proteins of colorectal cancer cells
   403872 (NRAS)
GTP-binding proteins [BR:cfa04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    403872 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA
Other DBs
NCBI-GeneID: 403872
NCBI-ProteinID: NP_001273994
Ensembl: ENSCAFG00000009532
VGNC: 43959
UniProt: A0A8C0S329 A0A8I3PXY1
LinkDB
Position
17:complement(52062320..52069399)
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca
atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac
cgaaaacaggtggttatagacggtgaaacctgtctgttggatatactggatacagctggt
caagaagagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt
gtatttgccatcaataatagcaaatcatttgcagacattaacctctacagggaacagatt
aagcgagtaaaagattcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg
ccaacaaggacagttgacacaaaacaagcccatgaactggccaagagttatgggattcca
ttcattgaaacctcagccaagaccagacagggtgtcgaggatgccttttacacactggta
agagaaatacgtcagtaccgaatgaagaaactcaacagcagtgatgatgggactcaaggt
tgtatggggttaccatgtgtggtgatgtaa

DBGET integrated database retrieval system