Canis lupus familiaris (dog): 403872 Help Entry 403872            CDS       T01007                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism cfa  Canis lupus familiaris (dog) Pathway cfa01521   EGFR tyrosine kinase inhibitor resistance cfa01522   Endocrine resistance cfa04010   MAPK signaling pathway cfa04012   ErbB signaling pathway cfa04014   Ras signaling pathway cfa04015   Rap1 signaling pathway cfa04062   Chemokine signaling pathway cfa04068   FoxO signaling pathway cfa04071   Sphingolipid signaling pathway cfa04072   Phospholipase D signaling pathway cfa04137   Mitophagy - animal cfa04140   Autophagy - animal cfa04150   mTOR signaling pathway cfa04151   PI3K-Akt signaling pathway cfa04210   Apoptosis cfa04211   Longevity regulating pathway cfa04213   Longevity regulating pathway - multiple species cfa04218   Cellular senescence cfa04360   Axon guidance cfa04370   VEGF signaling pathway cfa04371   Apelin signaling pathway cfa04540   Gap junction cfa04550   Signaling pathways regulating pluripotency of stem cells cfa04625   C-type lectin receptor signaling pathway cfa04650   Natural killer cell mediated cytotoxicity cfa04660   T cell receptor signaling pathway cfa04662   B cell receptor signaling pathway cfa04664   Fc epsilon RI signaling pathway cfa04714   Thermogenesis cfa04720   Long-term potentiation cfa04722   Neurotrophin signaling pathway cfa04725   Cholinergic synapse cfa04726   Serotonergic synapse cfa04730   Long-term depression cfa04810   Regulation of actin cytoskeleton cfa04910   Insulin signaling pathway cfa04912   GnRH signaling pathway cfa04915   Estrogen signaling pathway cfa04916   Melanogenesis cfa04917   Prolactin signaling pathway cfa04919   Thyroid hormone signaling pathway cfa04921   Oxytocin signaling pathway cfa04926   Relaxin signaling pathway cfa04929   GnRH secretion cfa04933   AGE-RAGE signaling pathway in diabetic complications cfa04935   Growth hormone synthesis, secretion and action cfa05010   Alzheimer disease cfa05022   Pathways of neurodegeneration - multiple diseases cfa05034   Alcoholism cfa05160   Hepatitis C cfa05161   Hepatitis B cfa05163   Human cytomegalovirus infection cfa05165   Human papillomavirus infection cfa05166   Human T-cell leukemia virus 1 infection cfa05167   Kaposi sarcoma-associated herpesvirus infection cfa05170   Human immunodeficiency virus 1 infection cfa05200   Pathways in cancer cfa05203   Viral carcinogenesis cfa05205   Proteoglycans in cancer cfa05206   MicroRNAs in cancer cfa05207   Chemical carcinogenesis - receptor activation cfa05208   Chemical carcinogenesis - reactive oxygen species cfa05210   Colorectal cancer cfa05211   Renal cell carcinoma cfa05213   Endometrial cancer cfa05214   Glioma cfa05215   Prostate cancer cfa05216   Thyroid cancer cfa05218   Melanoma cfa05219   Bladder cancer cfa05220   Chronic myeloid leukemia cfa05221   Acute myeloid leukemia cfa05223   Non-small cell lung cancer cfa05224   Breast cancer cfa05225   Hepatocellular carcinoma cfa05226   Gastric cancer cfa05230   Central carbon metabolism in cancer cfa05231   Choline metabolism in cancer cfa05235   PD-L1 expression and PD-1 checkpoint pathway in cancer cfa05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cfa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     403872 (NRAS)    04012 ErbB signaling pathway     403872 (NRAS)    04014 Ras signaling pathway     403872 (NRAS)    04015 Rap1 signaling pathway     403872 (NRAS)    04370 VEGF signaling pathway     403872 (NRAS)    04371 Apelin signaling pathway     403872 (NRAS)    04068 FoxO signaling pathway     403872 (NRAS)    04072 Phospholipase D signaling pathway     403872 (NRAS)    04071 Sphingolipid signaling pathway     403872 (NRAS)    04151 PI3K-Akt signaling pathway     403872 (NRAS)    04150 mTOR signaling pathway     403872 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     403872 (NRAS)    04137 Mitophagy - animal     403872 (NRAS)   09143 Cell growth and death    04210 Apoptosis     403872 (NRAS)    04218 Cellular senescence     403872 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     403872 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     403872 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     403872 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     403872 (NRAS)    04650 Natural killer cell mediated cytotoxicity     403872 (NRAS)    04660 T cell receptor signaling pathway     403872 (NRAS)    04662 B cell receptor signaling pathway     403872 (NRAS)    04664 Fc epsilon RI signaling pathway     403872 (NRAS)    04062 Chemokine signaling pathway     403872 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     403872 (NRAS)    04929 GnRH secretion     403872 (NRAS)    04912 GnRH signaling pathway     403872 (NRAS)    04915 Estrogen signaling pathway     403872 (NRAS)    04917 Prolactin signaling pathway     403872 (NRAS)    04921 Oxytocin signaling pathway     403872 (NRAS)    04926 Relaxin signaling pathway     403872 (NRAS)    04935 Growth hormone synthesis, secretion and action     403872 (NRAS)    04919 Thyroid hormone signaling pathway     403872 (NRAS)    04916 Melanogenesis     403872 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     403872 (NRAS)    04726 Serotonergic synapse     403872 (NRAS)    04720 Long-term potentiation     403872 (NRAS)    04730 Long-term depression     403872 (NRAS)    04722 Neurotrophin signaling pathway     403872 (NRAS)   09158 Development and regeneration    04360 Axon guidance     403872 (NRAS)   09149 Aging    04211 Longevity regulating pathway     403872 (NRAS)    04213 Longevity regulating pathway - multiple species     403872 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     403872 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     403872 (NRAS)    05206 MicroRNAs in cancer     403872 (NRAS)    05205 Proteoglycans in cancer     403872 (NRAS)    05207 Chemical carcinogenesis - receptor activation     403872 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     403872 (NRAS)    05203 Viral carcinogenesis     403872 (NRAS)    05230 Central carbon metabolism in cancer     403872 (NRAS)    05231 Choline metabolism in cancer     403872 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     403872 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     403872 (NRAS)    05225 Hepatocellular carcinoma     403872 (NRAS)    05226 Gastric cancer     403872 (NRAS)    05214 Glioma     403872 (NRAS)    05216 Thyroid cancer     403872 (NRAS)    05221 Acute myeloid leukemia     403872 (NRAS)    05220 Chronic myeloid leukemia     403872 (NRAS)    05218 Melanoma     403872 (NRAS)    05211 Renal cell carcinoma     403872 (NRAS)    05219 Bladder cancer     403872 (NRAS)    05215 Prostate cancer     403872 (NRAS)    05213 Endometrial cancer     403872 (NRAS)    05224 Breast cancer     403872 (NRAS)    05223 Non-small cell lung cancer     403872 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     403872 (NRAS)    05170 Human immunodeficiency virus 1 infection     403872 (NRAS)    05161 Hepatitis B     403872 (NRAS)    05160 Hepatitis C     403872 (NRAS)    05163 Human cytomegalovirus infection     403872 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     403872 (NRAS)    05165 Human papillomavirus infection     403872 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     403872 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     403872 (NRAS)   09165 Substance dependence    05034 Alcoholism     403872 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     403872 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     403872 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     403872 (NRAS)    01522 Endocrine resistance     403872 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cfa04131]     403872 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfa04147]     403872 (NRAS)    04031 GTP-binding proteins [BR:cfa04031]     403872 (NRAS) Membrane trafficking [BR:cfa04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     403872 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     403872 (NRAS) Exosome [BR:cfa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    403872 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    403872 (NRAS)   Exosomal proteins of breast cancer cells    403872 (NRAS)   Exosomal proteins of colorectal cancer cells    403872 (NRAS) GTP-binding proteins [BR:cfa04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     403872 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA Motif Other DBs NCBI-GeneID:  403872 NCBI-ProteinID:  NP_001273994 Ensembl:  ENSCAFG00000009532 VGNC:  43959 UniProt:  A0A8C0S329 A0A8I3PXY1 LinkDB All DBs Position 17:complement(52062320..52069399) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac cgaaaacaggtggttatagacggtgaaacctgtctgttggatatactggatacagctggt caagaagagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt gtatttgccatcaataatagcaaatcatttgcagacattaacctctacagggaacagatt aagcgagtaaaagattcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg ccaacaaggacagttgacacaaaacaagcccatgaactggccaagagttatgggattcca ttcattgaaacctcagccaagaccagacagggtgtcgaggatgccttttacacactggta agagaaatacgtcagtaccgaatgaagaaactcaacagcagtgatgatgggactcaaggt tgtatggggttaccatgtgtggtgatgtaa

DBGET integrated database retrieval system