Canis lupus familiaris (dog): 403954 Help Entry 403954            CDS       T01007                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism cfa  Canis lupus familiaris (dog) Pathway cfa04014   Ras signaling pathway cfa04015   Rap1 signaling pathway cfa04022   cGMP-PKG signaling pathway cfa04024   cAMP signaling pathway cfa04062   Chemokine signaling pathway cfa04071   Sphingolipid signaling pathway cfa04072   Phospholipase D signaling pathway cfa04081   Hormone signaling cfa04144   Endocytosis cfa04150   mTOR signaling pathway cfa04270   Vascular smooth muscle contraction cfa04310   Wnt signaling pathway cfa04350   TGF-beta signaling pathway cfa04360   Axon guidance cfa04510   Focal adhesion cfa04520   Adherens junction cfa04530   Tight junction cfa04611   Platelet activation cfa04621   NOD-like receptor signaling pathway cfa04625   C-type lectin receptor signaling pathway cfa04660   T cell receptor signaling pathway cfa04670   Leukocyte transendothelial migration cfa04722   Neurotrophin signaling pathway cfa04810   Regulation of actin cytoskeleton cfa04921   Oxytocin signaling pathway cfa04928   Parathyroid hormone synthesis, secretion and action cfa04972   Pancreatic secretion cfa05100   Bacterial invasion of epithelial cells cfa05132   Salmonella infection cfa05133   Pertussis cfa05135   Yersinia infection cfa05152   Tuberculosis cfa05163   Human cytomegalovirus infection cfa05200   Pathways in cancer cfa05203   Viral carcinogenesis cfa05205   Proteoglycans in cancer cfa05206   MicroRNAs in cancer cfa05210   Colorectal cancer cfa05417   Lipid and atherosclerosis cfa05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cfa00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     403954 (RHOA)    04015 Rap1 signaling pathway     403954 (RHOA)    04310 Wnt signaling pathway     403954 (RHOA)    04350 TGF-beta signaling pathway     403954 (RHOA)    04072 Phospholipase D signaling pathway     403954 (RHOA)    04071 Sphingolipid signaling pathway     403954 (RHOA)    04024 cAMP signaling pathway     403954 (RHOA)    04022 cGMP-PKG signaling pathway     403954 (RHOA)    04150 mTOR signaling pathway     403954 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     403954 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     403954 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     403954 (RHOA)    04660 T cell receptor signaling pathway     403954 (RHOA)    04670 Leukocyte transendothelial migration     403954 (RHOA)    04062 Chemokine signaling pathway     403954 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     403954 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     403954 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     403954 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     403954 (RHOA)   09158 Development and regeneration    04360 Axon guidance     403954 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     403954 (RHOA)    05206 MicroRNAs in cancer     403954 (RHOA)    05205 Proteoglycans in cancer     403954 (RHOA)    05203 Viral carcinogenesis     403954 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     403954 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     403954 (RHOA)   09171 Infectious disease: bacterial    05135 Yersinia infection     403954 (RHOA)    05133 Pertussis     403954 (RHOA)    05152 Tuberculosis     403954 (RHOA)    05100 Bacterial invasion of epithelial cells     403954 (RHOA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     403954 (RHOA)    05418 Fluid shear stress and atherosclerosis     403954 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cfa04131]     403954 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfa04147]     403954 (RHOA)    04031 GTP-binding proteins [BR:cfa04031]     403954 (RHOA) Membrane trafficking [BR:cfa04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     403954 (RHOA) Exosome [BR:cfa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    403954 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    403954 (RHOA)   Exosomal proteins of colorectal cancer cells    403954 (RHOA)   Exosomal proteins of bladder cancer cells    403954 (RHOA) GTP-binding proteins [BR:cfa04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     403954 (RHOA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  403954 NCBI-ProteinID:  NP_001003273 Ensembl:  ENSCAFG00000023066 VGNC:  81924 UniProt:  A0A8C0T4F4 A0A8I3PVV6 LinkDB All DBs Position 20:39743026..39805566 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaactggtgattgttggtgatggagcctgtggtaagacttgt ttgctcatcgtctttagcaaggaccagttcccagaggtgtatgtacccacagtgtttgag aactatgtggcagatattgaagttgatggaaagcaggtagagttggctttgtgggataca gctgggcaggaagattatgatcgcttgaggcctctctcctatccagacactgatgttata ctgatgtgtttctctattgacagccctgatagcttagaaaacatcccagaaaaatggacc ccagaagtcaagcacttctgtcccaacgtgcccatcatcctggttgggaacaagaaggat cttcggaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccggtgaaa ccggaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctgcaa gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system