Canis lupus familiaris (dog): 403958 Help Entry 403958            CDS       T01007                                  Symbol RAB10 Name (RefSeq) ras-related protein Rab-10   KO K07903   Ras-related protein Rab-10 Organism cfa  Canis lupus familiaris (dog) Pathway cfa04144   Endocytosis cfa04152   AMPK signaling pathway Brite KEGG Orthology (KO) [BR:cfa00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     403958 (RAB10)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     403958 (RAB10)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cfa04131]     403958 (RAB10)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfa04147]     403958 (RAB10)    04031 GTP-binding proteins [BR:cfa04031]     403958 (RAB10) Membrane trafficking [BR:cfa04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     403958 (RAB10)  Protein recycling   Rab GTPases and associated proteins     403958 (RAB10) Exosome [BR:cfa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    403958 (RAB10)   Exosomal proteins of other body fluids (saliva and urine)    403958 (RAB10)   Exosomal proteins of colorectal cancer cells    403958 (RAB10)   Exosomal proteins of bladder cancer cells    403958 (RAB10) GTP-binding proteins [BR:cfa04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     403958 (RAB10) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 SRPRB AAA_7 DUF3963 Motif Other DBs NCBI-GeneID:  403958 NCBI-ProteinID:  NP_001003277 Ensembl:  ENSCAFG00000004250 VGNC:  45247 LinkDB All DBs Position 17 Genome browser AA seq 200 aa AA seqDB search MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKL QIWDTAGQERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLL GNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPN SENVDISSGGGVTGWKSKCC NT seq 603 nt NT seq  +upstreamnt  +downstreamnt atggcgaagaagacgtacgacctgcttttcaagctgctcctgatcggagactcgggagta gggaagacctgcgtcctttttcgtttttcggatgatgccttcaataccacctttatttcc accataggaatagattttaagatcaaaacagttgaattacaaggaaagaagatcaagcta cagatatgggatacagcaggccaggagcgatttcacaccatcacaacctcctattacaga ggagcaatgggtatcatgctagtatatgacatcaccaatggtaaaagttttgaaaacatc agcaaatggcttagaaacatagatgagcatgccaatgaagatgtggaaagaatgttacta ggaaacaaatgtgatatggacgataaaagagttgtacctaaaggaaaaggagaacagatt gcaagggagcatggtattagattttttgagactagtgcaaaagcaaatataaacatcgaa aaggctttcctcacattagctgaagatatccttcgaaagacccctgtaaaagagcccaac agtgaaaatgtagatatcagcagtggaggcggcgtgacaggctggaagagcaaatgttgc tga

DBGET integrated database retrieval system