Canis lupus familiaris (dog): 403993 Help Entry 403993            CDS       T01007                                  Symbol SST Name (RefSeq) somatostatin precursor   KO K05237   somatostatin Organism cfa  Canis lupus familiaris (dog) Pathway cfa04024   cAMP signaling pathway cfa04080   Neuroactive ligand-receptor interaction cfa04081   Hormone signaling cfa04935   Growth hormone synthesis, secretion and action cfa04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:cfa00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     403993 (SST)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     403993 (SST)    04081 Hormone signaling     403993 (SST)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     403993 (SST)   09154 Digestive system    04971 Gastric acid secretion     403993 (SST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cfa04052]     403993 (SST) Cytokines and neuropeptides [BR:cfa04052]  Neuropeptides   GPCR binding    403993 (SST) SSDB OrthologParalogGFIT Motif Pfam:  Somatostatin NLRC4_HD2 Motif Other DBs NCBI-GeneID:  403993 NCBI-ProteinID:  NP_001003307 Ensembl:  ENSCAFG00000013891 VGNC:  46842 UniProt:  P49670 LinkDB All DBs Position 34 Genome browser AA seq 116 aa AA seqDB search MLSCRLQCALAALSIVLALGGVTCAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP NQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgctgtcctgccgcctccagtgcgcgctggccgcgctgtccatcgtcctggctctgggc ggtgtcacctgcgcgccctcggacccccgactccgccagtttctgcagaagtccctggct gccgccgcggggaagcaggaactggccaagtacttcttggcagagctgctgtctgaaccc aaccagacagagaatgatgccctggaacctgaagatttgtcccaggctgctgagcaggat gaaatgaggctggaactgcagagatctgctaactcaaaccccgccatggcaccccgagaa cgcaaagctggctgcaagaatttcttctggaagactttcacatcctgttag

DBGET integrated database retrieval system