Canis lupus familiaris (dog): 442934 Help Entry 442934            CDS       T01007                                  Symbol IFNA5 Name (RefSeq) interferon alpha-3 precursor   KO K05414   interferon alpha Organism cfa  Canis lupus familiaris (dog) Pathway cfa04060   Cytokine-cytokine receptor interaction cfa04151   PI3K-Akt signaling pathway cfa04217   Necroptosis cfa04620   Toll-like receptor signaling pathway cfa04621   NOD-like receptor signaling pathway cfa04622   RIG-I-like receptor signaling pathway cfa04623   Cytosolic DNA-sensing pathway cfa04630   JAK-STAT signaling pathway cfa04650   Natural killer cell mediated cytotoxicity cfa04936   Alcoholic liver disease cfa05152   Tuberculosis cfa05160   Hepatitis C cfa05161   Hepatitis B cfa05162   Measles cfa05163   Human cytomegalovirus infection cfa05164   Influenza A cfa05165   Human papillomavirus infection cfa05167   Kaposi sarcoma-associated herpesvirus infection cfa05168   Herpes simplex virus 1 infection cfa05169   Epstein-Barr virus infection cfa05170   Human immunodeficiency virus 1 infection cfa05171   Coronavirus disease - COVID-19 cfa05200   Pathways in cancer cfa05320   Autoimmune thyroid disease cfa05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cfa00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     442934 (IFNA5)    04151 PI3K-Akt signaling pathway     442934 (IFNA5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     442934 (IFNA5)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     442934 (IFNA5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     442934 (IFNA5)    04621 NOD-like receptor signaling pathway     442934 (IFNA5)    04622 RIG-I-like receptor signaling pathway     442934 (IFNA5)    04623 Cytosolic DNA-sensing pathway     442934 (IFNA5)    04650 Natural killer cell mediated cytotoxicity     442934 (IFNA5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     442934 (IFNA5)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     442934 (IFNA5)    05161 Hepatitis B     442934 (IFNA5)    05160 Hepatitis C     442934 (IFNA5)    05171 Coronavirus disease - COVID-19     442934 (IFNA5)    05164 Influenza A     442934 (IFNA5)    05162 Measles     442934 (IFNA5)    05168 Herpes simplex virus 1 infection     442934 (IFNA5)    05163 Human cytomegalovirus infection     442934 (IFNA5)    05167 Kaposi sarcoma-associated herpesvirus infection     442934 (IFNA5)    05169 Epstein-Barr virus infection     442934 (IFNA5)    05165 Human papillomavirus infection     442934 (IFNA5)   09171 Infectious disease: bacterial    05152 Tuberculosis     442934 (IFNA5)   09163 Immune disease    05320 Autoimmune thyroid disease     442934 (IFNA5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     442934 (IFNA5)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     442934 (IFNA5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cfa04052]     442934 (IFNA5) Cytokines and neuropeptides [BR:cfa04052]  Cytokines   Interferons    442934 (IFNA5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  442934 NCBI-ProteinID:  NP_001006648 Ensembl:  ENSCAFG00000041326 UniProt:  Q75UL7 LinkDB All DBs Position 11:complement(39392080..39392643) Genome browser AA seq 187 aa AA seqDB search MALPCSFSVALVLLSCHSLCCLACDLPDTHSLRNWRVLTLLGQMRRLSASSCDHYTTDFA FPKELFDGQRLQEAQALSVVHVMTQKVFHLFCTNMSSAPWNMTLLEELCSGLSEQLDDLD ACPLQEAGLAETPLMHEDSTLRTYFQRISLYLQDRNHSPCAWEMVRAEIGRSFFSLTILR ERVRRRK NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atggccctgccctgctccttctcggtggccctggtgctgctcagctgccactccctgtgc tgtctggcttgcgacctgcccgacacccacagcctgcgcaactggagggtcctgacgctc ctgggacagatgaggagactctccgccagctcttgtgaccactacaccactgactttgcc ttccccaaggaactgtttgatggccagcggctccaggaggcgcaagccctctctgtggtc cacgtgatgacccagaaggtcttccacctcttctgcacgaacatgtcctctgctccttgg aacatgaccctcctggaggaattgtgctcggggctctctgagcagctggatgacctggat gcctgtcccctgcaggaggcagggctggccgagacccccctcatgcatgaagactccacc ctgaggacctacttccaaaggatctccctctacctgcaagacaggaaccacagcccgtgt gcctgggagatggtccgagcagaaatcgggagatccttcttctccttgaccatcttgcga gaaagagtaaggaggaggaaatga

DBGET integrated database retrieval system