Canis lupus familiaris (dog): 474394 Help Entry 474394            CDS       T01007                                  Symbol RAB5B Name (RefSeq) ras-related protein Rab-5B   KO K07888   Ras-related protein Rab-5B Organism cfa  Canis lupus familiaris (dog) Pathway cfa04014   Ras signaling pathway cfa04137   Mitophagy - animal cfa04144   Endocytosis cfa04145   Phagosome cfa04148   Efferocytosis cfa04962   Vasopressin-regulated water reabsorption cfa05132   Salmonella infection cfa05146   Amoebiasis cfa05152   Tuberculosis Brite KEGG Orthology (KO) [BR:cfa00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     474394 (RAB5B)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     474394 (RAB5B)    04145 Phagosome     474394 (RAB5B)    04137 Mitophagy - animal     474394 (RAB5B)    04148 Efferocytosis     474394 (RAB5B)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     474394 (RAB5B)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     474394 (RAB5B)    05152 Tuberculosis     474394 (RAB5B)   09174 Infectious disease: parasitic    05146 Amoebiasis     474394 (RAB5B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cfa04131]     474394 (RAB5B)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfa04147]     474394 (RAB5B)    04031 GTP-binding proteins [BR:cfa04031]     474394 (RAB5B) Membrane trafficking [BR:cfa04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     474394 (RAB5B)  Endosome - Lysosome transport     474394 (RAB5B) Exosome [BR:cfa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    474394 (RAB5B)   Exosomal proteins of other body fluids (saliva and urine)    474394 (RAB5B)   Exosomal proteins of colorectal cancer cells    474394 (RAB5B)   Exosomal proteins of melanoma cells    474394 (RAB5B) GTP-binding proteins [BR:cfa04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     474394 (RAB5B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  474394 NCBI-ProteinID:  XP_531627 Ensembl:  ENSCAFG00000000087 VGNC:  45292 UniProt:  A0A8C0Q6S0 A0A8I3RUF7 LinkDB All DBs Position 10:369626..387933 Genome browser AA seq 215 aa AA seqDB search MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK LPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgactagcagaagcacagccaggcccaatgggcagccccaggccagcaaaatatgccag ttcaaattggtcctgctgggtgaatctgcagtggggaagtctagcctggtattacgtttt gtcaaagggcagtttcatgagtaccaggagagcaccattggagcggccttcctcacccag tctgtttgtctagatgacacaacagtcaagtttgagatctgggacacagctgggcaggag cgataccatagcttggcccccatgtactacaggggtgcccaagctgccattgtggtttat gacattactaatcaggaaaccttcgctcgagcaaagacctgggtaaaggaactacagcga caggccagtcctagcatcgttattgccctggcggggaacaaagctgatctggccaataag cgcatggtggagtatgaagaggcccaggcgtatgcagatgacaacagcttattgtttatg gagacttcagccaagacagctatgaacgtgaacgatctcttcctggctatagctaagaag ttgccaaagagtgaaccccagaatctggggggtgcagcaggccgaagccggggtgtggat ctccatgagcagtcccagcagaacaagagccagtgttgtagcaactga

DBGET integrated database retrieval system