Canis lupus familiaris (dog): 474750 Help Entry 474750            CDS       T01007                                  Symbol DCTN3 Name (RefSeq) dynactin subunit 3 isoform X2   KO K10425   dynactin 3 Organism cfa  Canis lupus familiaris (dog) Pathway cfa04145   Phagocytosis cfa04814   Motor proteins cfa05014   Amyotrophic lateral sclerosis cfa05016   Huntington disease cfa05022   Pathways of neurodegeneration - multiple diseases cfa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cfa00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     474750 (DCTN3)   09142 Cell motility    04814 Motor proteins     474750 (DCTN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     474750 (DCTN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     474750 (DCTN3)    05016 Huntington disease     474750 (DCTN3)    05022 Pathways of neurodegeneration - multiple diseases     474750 (DCTN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cfa03036]     474750 (DCTN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:cfa04812]     474750 (DCTN3) Chromosome and associated proteins [BR:cfa03036]  Eukaryotic type   Centrosome formation proteins    Microtubules and associated factors     Dynactin complex      474750 (DCTN3) Cytoskeleton proteins [BR:cfa04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dynactins      474750 (DCTN3) SSDB OrthologParalogGFIT Motif Pfam:  Dynactin_p22 DUF4011 Spidroin_MaSp TetR_C_24 Motif Other DBs NCBI-GeneID:  474750 NCBI-ProteinID:  XP_022281243 Ensembl:  ENSCAFG00000001937 VGNC:  39818 LinkDB All DBs Position 11 Genome browser AA seq 185 aa AA seqDB search MAAVTDVQRLQARVEELERWVYGSGGPRGSRKVADGLVKVQVALGNIASKRERVKILYKK IEDLIKYLDPEYIDRIAIPDASKLQFILAEQFILSQIALLEQVEALVPMLDSAHIKAVPE HAARLQRLAQIHIQQQDQCVEVTEESKALLEEYNKTTMLLSKQFVQWDELLCQLEAAKQV KPAEE NT seq 558 nt NT seq  +upstreamnt  +downstreamnt atggcggctgtgaccgatgtgcagcggctacaggcccgtgtggaggaactggagcgctgg gtgtacgggtcgggcgggccgcgcggctcgcggaaggtggctgatggcctagtcaaggta caggtggctttggggaacattgccagcaagagggagagggtgaagattctgtacaaaaag attgaagacctgatcaaatacctggatcctgagtatattgaccgcattgccatacctgat gcctctaagctgcagtttatattagcagagcagtttatcttatcccagattgcactcctg gagcaggtagaggccttggtgcccatgctggacagcgctcacatcaaagccgttcctgag catgctgcccgcctgcagcgcttggcccagatccacatccagcagcaggaccagtgtgtg gaggtcactgaggagtccaaggctctcctggaggaatacaacaagactacaatgcttctc tccaagcaatttgtgcagtgggatgaactgctttgccagctagaggccgccaagcaagtg aagccagcagaggagtaa

DBGET integrated database retrieval system