Canis lupus familiaris (dog): 475851 Help Entry 475851            CDS       T01007                                  Symbol S100A10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism cfa  Canis lupus familiaris (dog) Pathway cfa04382   Cornified envelope formation cfa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cfa00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     475851 (S100A10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     475851 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfa04147]     475851 (S100A10) Exosome [BR:cfa04147]  Exosomal proteins   Exosomal proteins of microglial cells    475851 (S100A10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8 EF-hand_6 TMP_3 Motif Other DBs NCBI-GeneID:  475851 NCBI-ProteinID:  XP_003432305 Ensembl:  ENSCAFG00000023111 UniProt:  E2RGM0 A0A8C0MWD1 LinkDB All DBs Position 17:complement(60427818..60438527) Genome browser AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGKVGFQSFFSLIAGLTIACNDYFVIHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccgtctcaaatggaacatgccatggaaaccatgatgttcacgtttcacaagtttgct ggggataaaggatacttgacaaaggaagacctgagagtactcatggaaaaggaattccca ggatttttggaaaatcaaaaagaccctctggccgtggacaaaataatgaaggacctcgac cagtgccgagatggcaaagtgggcttccagagcttcttttcactaattgctgggctcacc attgcatgcaatgactattttgtaatacacatgaagcagaagggcaagaaatag

DBGET integrated database retrieval system