Canis lupus familiaris (dog): 475916 Help Entry 475916            CDS       T01007                                  Symbol H3-3B Name (RefSeq) histone H3.3A   KO K11253   histone H3 Organism cfa  Canis lupus familiaris (dog) Pathway cfa04613   Neutrophil extracellular trap formation cfa05034   Alcoholism cfa05202   Transcriptional misregulation in cancer cfa05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cfa00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     475916 (H3-3B)  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     475916 (H3-3B)   09163 Immune disease    05322 Systemic lupus erythematosus     475916 (H3-3B)   09165 Substance dependence    05034 Alcoholism     475916 (H3-3B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cfa03036]     475916 (H3-3B)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfa04147]     475916 (H3-3B) Chromosome and associated proteins [BR:cfa03036]  Eukaryotic type   Nucleosome assembly factors    Histones     475916 (H3-3B) Exosome [BR:cfa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    475916 (H3-3B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  475916 NCBI-ProteinID:  XP_858804 Ensembl:  ENSCAFG00000004914 VGNC:  83695 UniProt:  E2R6K5 A0A8C0LQ69 LinkDB All DBs Position 9:5485743..5488166 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgaaccaagcagactgcccgtaaatccacgggtgggaaagcgccccgcaaacag ctggccactaaagccgcccggaaaagcgccccttctactggcggggtgaaaaaacctcat cgctacaggcctgggaccgtagcccttcgggagatccgccgttaccagaagtccaccgag cttctgatccggaagctgcctttccagaggttggtgagggagatcgcccaggatttcaaa accgatctgaggtttcagagcgccgccattggcgcgcttcaggaggccagtgaagcgtac ctggtgggtttatttgaagatactaatctgtgtgccatccacgctaagagagtcaccatc atgcccaaagacatccagttggctcgccggatacggggagagagagcttaa

DBGET integrated database retrieval system