Canis lupus familiaris (dog): 476022 Help Entry 476022            CDS       T01007                                  Symbol CFL1 Name (RefSeq) cofilin-1   KO K05765   cofilin Organism cfa  Canis lupus familiaris (dog) Pathway cfa04360   Axon guidance cfa04666   Fc gamma R-mediated phagocytosis cfa04810   Regulation of actin cytoskeleton cfa05133   Pertussis cfa05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:cfa00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     476022 (CFL1)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     476022 (CFL1)   09158 Development and regeneration    04360 Axon guidance     476022 (CFL1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     476022 (CFL1)   09171 Infectious disease: bacterial    05133 Pertussis     476022 (CFL1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cfa04131]     476022 (CFL1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:cfa04812]     476022 (CFL1)    04147 Exosome [BR:cfa04147]     476022 (CFL1) Membrane trafficking [BR:cfa04131]  Others   Actin-binding proteins    Others     476022 (CFL1) Cytoskeleton proteins [BR:cfa04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      476022 (CFL1) Exosome [BR:cfa04147]  Exosomal proteins   Proteins found in most exosomes    476022 (CFL1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  476022 NCBI-ProteinID:  XP_533231 Ensembl:  ENSCAFG00000024955 VGNC:  56088 UniProt:  A0A8C0NGL0 A0A8I3P3F3 LinkDB All DBs Position 18:50013157..50016753 Genome browser AA seq 166 aa AA seqDB search MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV GQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcctctggcgtggcggtttctgatggcgtcatcaaagtgttcaatgacatgaaggtg cgtaagtcttcaacacccgaggaagtgaagaagcgcaagaaggcagttcttttctgcctg agcgaggacaagaagaacatcatcctcgaggagggcaaggagatcctggtaggtgatgtg ggccagactgtagatgacccctacgccacctttgtcaagatgctaccagacaaggactgc cgctatgccctctatgacgcaacctatgagaccaaggagagcaagaaggaggacctggtg tttatcttctgggcacctgagtctgcaccccttaagagcaaaatgatttatgccagctcc aaggatgccatcaagaaaaagctgactgggatcaagcatgagttacaagcaaactgctac gaggaggtcaaggaccgctgcaccctggcagagaaactggggggcagtgccgtcatctct ctggagggcaagcctttgtga

DBGET integrated database retrieval system