Canis lupus familiaris (dog): 478401 Help Entry 478401            CDS       T01007                                  Symbol CLDN8 Name (RefSeq) claudin-8   KO K06087   claudin Organism cfa  Canis lupus familiaris (dog) Pathway cfa03272   Virion - Hepatitis viruses cfa04382   Cornified envelope formation cfa04514   Cell adhesion molecules cfa04530   Tight junction cfa04670   Leukocyte transendothelial migration cfa05160   Hepatitis C Brite KEGG Orthology (KO) [BR:cfa00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     478401 (CLDN8)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     478401 (CLDN8)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     478401 (CLDN8)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     478401 (CLDN8)   09158 Development and regeneration    04382 Cornified envelope formation     478401 (CLDN8)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     478401 (CLDN8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cfa03037]     478401 (CLDN8)    04147 Exosome [BR:cfa04147]     478401 (CLDN8)    04515 Cell adhesion molecules [BR:cfa04515]     478401 (CLDN8) Cilium and associated proteins [BR:cfa03037]  Other cilia and associated proteins   Stereociliary proteins    478401 (CLDN8) Exosome [BR:cfa04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    478401 (CLDN8)   Exosomal proteins of colorectal cancer cells    478401 (CLDN8) Cell adhesion molecules [BR:cfa04515]  Immunoglobulin superfamily   L1 family    478401 (CLDN8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Comm Clc-like Motif Other DBs NCBI-GeneID:  478401 NCBI-ProteinID:  XP_005638865 VGNC:  53023 LinkDB All DBs Position 31:complement(25081031..25083309) Genome browser AA seq 225 aa AA seqDB search MATYALQIAGLVLGGVGMVGTLAVTIMPQWRVSAFIGSNIVVFENFWEGLWMNCVRQANI RMQCKVYDSLLALSPDLQASRGLMCAASVLSFLAFMTAVLGMKCTRCTGDDEKIKGHILL TAGIIFIVTGILVLIPVSWVANSIIREFYNPIVETAQKHELGDALYIGWTTALVLIAGGA LFCCVSCYSEKSRSYRYSIPSHRTAQKSYHMEKKSPSVYSRSQYV NT seq 678 nt NT seq  +upstreamnt  +downstreamnt atggctacctacgctctgcaaattgctggactggtgcttggtggtgttggcatggtgggc acactggctgttaccatcatgcctcagtggagagtgtctgccttcattggaagcaacatt gtggtttttgaaaacttctgggagggactgtggatgaattgcgtgagacaagctaacatt aggatgcaatgcaaagtctacgattccctgctggctctctctccagacctacaggcatcc agagggctgatgtgtgctgcgtctgtgctgtccttcctggctttcatgaccgctgtcctg ggcatgaaatgtaccaggtgcactggggacgatgagaagataaagggacacatattgctg acagctggtatcatcttcatcgtcacgggcatcctggtgctcatcccggtgagctgggtg gccaattccatcatcagagagttctacaacccaatagtggagactgcccaaaagcatgag cttggagatgctctctacataggctggaccaccgcgctggtgctgatcgctggaggggcc ctgttctgctgtgtttcctgttacagtgagaagagcagaagctacagatactccatacct tcccatcgcacagcccaaaaaagctatcacatggaaaagaagtcaccgagcgtgtactcc agaagtcagtatgtttag

DBGET integrated database retrieval system