Canis lupus familiaris (dog): 478493 Help Entry 478493            CDS       T01007                                  Symbol H2AZ1 Name (RefSeq) H2A histone family, member Z   KO K11251   histone H2A Organism cfa  Canis lupus familiaris (dog) Pathway cfa03082   ATP-dependent chromatin remodeling cfa04217   Necroptosis cfa04613   Neutrophil extracellular trap formation cfa05034   Alcoholism cfa05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cfa00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     478493 (H2AZ1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     478493 (H2AZ1)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     478493 (H2AZ1)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     478493 (H2AZ1)   09165 Substance dependence    05034 Alcoholism     478493 (H2AZ1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cfa03036]     478493 (H2AZ1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfa04147]     478493 (H2AZ1) Chromosome and associated proteins [BR:cfa03036]  Eukaryotic type   Nucleosome assembly factors    Histones     478493 (H2AZ1) Exosome [BR:cfa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    478493 (H2AZ1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Histone_H2A_C CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  478493 NCBI-ProteinID:  NP_001274021 Ensembl:  ENSCAFG00000010615 VGNC:  83696 UniProt:  A0A8C0Z4D4 A0A8I3PL79 LinkDB All DBs Position 32:20004606..20006940 Genome browser AA seq 128 aa AA seqDB search MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILE YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG KKGQQKTV NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggctggcggtaaggctgggaaggactccggaaaggccaagacaaaggcggtttcccgc tcacagagagccggcttgcagttcccggtgggccgtattcatcgacacctgaaatctagg acgaccagtcatggacgtgtgggcgcgactgccgctgtgtacagcgcagccatcctggag tacctcaccgcagaggtacttgaattggcaggaaatgcatcgaaagacttgaaggtaaag cgtattacccctcgtcacttgcaacttgctattcgtggagatgaagaattggattccctc atcaaggctacaattgctggtggtggtgttattccacacatccacaaatctctgattggg aagaaaggacaacagaagactgtttaa

DBGET integrated database retrieval system