Canis lupus familiaris (dog): 480558 Help Entry 480558            CDS       T01007                                  Symbol NME1 Name (RefSeq) nucleoside diphosphate kinase A   KO K00940   nucleoside-diphosphate kinase [EC:2.7.4.6] Organism cfa  Canis lupus familiaris (dog) Pathway cfa00230   Purine metabolism cfa00240   Pyrimidine metabolism cfa00983   Drug metabolism - other enzymes cfa01100   Metabolic pathways cfa01232   Nucleotide metabolism cfa01240   Biosynthesis of cofactors Module cfa_M00049   Adenine ribonucleotide biosynthesis, IMP => ADP,ATP cfa_M00050   Guanine ribonucleotide biosynthesis, IMP => GDP,GTP cfa_M00052   Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP cfa_M00053   Deoxyribonucleotide biosynthesis, ADP/GDP/CDP/UDP => dATP/dGTP/dCTP/dUTP cfa_M00938   Pyrimidine deoxyribonucleotide biosynthesis, UDP => dTTP Brite KEGG Orthology (KO) [BR:cfa00001]  09100 Metabolism   09104 Nucleotide metabolism    00230 Purine metabolism     480558 (NME1)    00240 Pyrimidine metabolism     480558 (NME1)   09111 Xenobiotics biodegradation and metabolism    00983 Drug metabolism - other enzymes     480558 (NME1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cfa04131]     480558 (NME1) Enzymes [BR:cfa01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.4  Phosphotransferases with a phosphate group as acceptor     2.7.4.6  nucleoside-diphosphate kinase      480558 (NME1) Membrane trafficking [BR:cfa04131]  Exocytosis   Calcium ion-dependent exocytosis    Kinases and associated proteins     480558 (NME1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NDK ArnR1-like_WHD Motif Other DBs NCBI-GeneID:  480558 NCBI-ProteinID:  NP_001019808 Ensembl:  ENSCAFG00000023628 UniProt:  Q50KA9 LinkDB All DBs Position 9:26321054..26326903 Genome browser AA seq 152 aa AA seqDB search MANSERTFIAIKPDGVQRSLVGEIIKRFEQKGFRLIAMKLIQASEDLLKEHYIDLKDRPF FAGLVKYMQSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS DSVESAEKEIGLWFQPEELVDYKSCAQNWIYE NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atggccaacagtgaacgcaccttcattgccatcaagcctgatggagtccagcgcagcctt gtgggagagatcatcaagcgtttcgagcaaaagggattccgcctcattgctatgaaatta atccaggcttctgaagaccttctcaaggagcactatattgacctgaaggaccgtccattc tttgccggcctggtgaagtacatgcagtcagggcctgtggttgccatggtgtgggagggc ctgaatgtggtgaagacaggccgagtgatgctcggggagaccaacccggcggactccaaa cctgggaccatccgtggggacttttgcatccaagttggcaggaacattatccatggcagc gattctgtggagagtgcggagaaggagattggcttgtggttccagcctgaagagctggtg gattacaagagctgtgctcagaactggatttatgagtga

DBGET integrated database retrieval system