Canis lupus familiaris (dog): 480601 Help Entry 480601            CDS       T01007                                  Name (RefSeq) regakine-1-like   KO K05408   C-C motif chemokine 3 Organism cfa  Canis lupus familiaris (dog) Pathway cfa04060   Cytokine-cytokine receptor interaction cfa04061   Viral protein interaction with cytokine and cytokine receptor cfa04062   Chemokine signaling pathway cfa04620   Toll-like receptor signaling pathway cfa05142   Chagas disease cfa05163   Human cytomegalovirus infection cfa05323   Rheumatoid arthritis cfa05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cfa00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     480601    04061 Viral protein interaction with cytokine and cytokine receptor     480601  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     480601    04062 Chemokine signaling pathway     480601  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     480601   09174 Infectious disease: parasitic    05142 Chagas disease     480601   09163 Immune disease    05323 Rheumatoid arthritis     480601   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     480601  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cfa04052]     480601    00536 Glycosaminoglycan binding proteins [BR:cfa00536]     480601 Cytokines and neuropeptides [BR:cfa04052]  Cytokines   Chemokines    480601 Glycosaminoglycan binding proteins [BR:cfa00536]  Heparan sulfate / Heparin   Chemokines    480601 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 V-ATPase_su_f DUF7451 NAL1_N Motif Other DBs NCBI-GeneID:  480601 NCBI-ProteinID:  XP_537721 Ensembl:  ENSCAFG00000032731 UniProt:  A0A8I3NA82 A0A8P0NRC8 LinkDB All DBs Position 9:36958096..36962984 Genome browser AA seq 94 aa AA seqDB search MKVSLIALIFLLILAALHSEANEELVNELTISPCCLTFISRRVSLRFVEGYQRTGDHCLT PGIIFLTHKGRQICANPNVAWVQEYIRHLDSLPK NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgaaggtcagcctcattgccctgatcttcctcctcattcttgctgccctccactctgag gccaatgaagaactagttaatgaattaacaatcagtccatgctgtttgaccttcatctca cggagagtctcactccggtttgtggaaggttatcagagaaccggtgaccattgcctcacc ccagggatcattttccttacccataagggcagacagatctgtgccaaccccaatgttgcc tgggtgcaggagtacatcagacacctagactctctgccaaagtga

DBGET integrated database retrieval system