Canis lupus familiaris (dog): 481110 Help Entry 481110            CDS       T01007                                  Symbol IL23A Name (RefSeq) interleukin-23 subunit alpha   KO K05426   interleukin 23 subunit alpha Organism cfa  Canis lupus familiaris (dog) Pathway cfa04060   Cytokine-cytokine receptor interaction cfa04625   C-type lectin receptor signaling pathway cfa04630   JAK-STAT signaling pathway cfa04659   Th17 cell differentiation cfa05133   Pertussis cfa05152   Tuberculosis cfa05200   Pathways in cancer cfa05321   Inflammatory bowel disease cfa05323   Rheumatoid arthritis Brite KEGG Orthology (KO) [BR:cfa00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     481110 (IL23A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     481110 (IL23A)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     481110 (IL23A)    04659 Th17 cell differentiation     481110 (IL23A)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     481110 (IL23A)   09171 Infectious disease: bacterial    05133 Pertussis     481110 (IL23A)    05152 Tuberculosis     481110 (IL23A)   09163 Immune disease    05323 Rheumatoid arthritis     481110 (IL23A)    05321 Inflammatory bowel disease     481110 (IL23A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cfa04052]     481110 (IL23A) Cytokines and neuropeptides [BR:cfa04052]  Cytokines   Interleukins    481110 (IL23A) SSDB OrthologParalogGFIT Motif Pfam:  IL23 IL6 Motif Other DBs NCBI-GeneID:  481110 NCBI-ProteinID:  XP_538231 Ensembl:  ENSCAFG00000000120 VGNC:  41972 UniProt:  A0A8C0NA50 A0A8I3N7Q4 LinkDB All DBs Position 10 Genome browser AA seq 193 aa AA seqDB search MLGSRAVMLLLLLLLLPWTAEPRAVPEGSSPAWIQGQQLSQKLCTLVWSAHPPMGHVDLP REEGDGETTSDVPRIQCGDGCDPQGLKDNSQFCLQRIHQGLVFYEKLLGSDIFTGEPSLL PDGPVGQLHANLLGLRQLLQPEGHHWETEQTPSPSPSQPWQRLLLRLKILRSLQAFVAVA ARVFAHGAATLSP NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atgctgggaagcagggctgtgatgctgctgctgctgctgctgctgctgccctggactgct gagccccgggctgtgcctgagggcagtagccctgcctggattcagggccagcagctctca cagaagctctgcacgctggtgtggagtgcacatcctcccatgggacatgtggacctacca agagaagagggagatggtgagactacaagtgatgtcccccgcatccagtgcggggatggc tgtgatccccaaggactcaaagacaacagtcagttctgcttacaaaggatccaccagggc ctggttttttatgagaaactgctgggctcagacattttcacaggggagccttctctactc cctgatggccctgtgggccagcttcacgccaacctcctgggccttaggcaactcttgcag ccagagggtcaccactgggagactgagcaaactccaagccccagtcccagccagccatgg cagcgcctcctcctccgcctcaagatccttcgcagcctccaggcctttgtggctgtagct gcccgggtctttgcccacggagcagcaaccctgagcccgtaa

DBGET integrated database retrieval system