Canis lupus familiaris (dog): 482202 Help Entry 482202            CDS       T01007                                  Symbol H2BU1 Name (RefSeq) histone H2B type 3-B   KO K11252   histone H2B Organism cfa  Canis lupus familiaris (dog) Pathway cfa04613   Neutrophil extracellular trap formation cfa05034   Alcoholism cfa05203   Viral carcinogenesis cfa05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cfa00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     482202 (H2BU1)  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     482202 (H2BU1)   09163 Immune disease    05322 Systemic lupus erythematosus     482202 (H2BU1)   09165 Substance dependence    05034 Alcoholism     482202 (H2BU1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cfa03036]     482202 (H2BU1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfa04147]     482202 (H2BU1) Chromosome and associated proteins [BR:cfa03036]  Eukaryotic type   Nucleosome assembly factors    Histones     482202 (H2BU1) Exosome [BR:cfa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    482202 (H2BU1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa ARM_TT21 LonB_AAA-LID CENP-T_C Motif Other DBs NCBI-GeneID:  482202 NCBI-ProteinID:  XP_539321 Ensembl:  ENSCAFG00000024333 VGNC:  83699 UniProt:  A0A8C0S0S9 A0A8I3N371 LinkDB All DBs Position 14:553764..555126 Genome browser AA seq 142 aa AA seqDB search MPAAELCSFCLERFATMPDPSKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYK VLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLP GELAKHAVSEGTKAVTKYTSSK NT seq 429 nt NT seq  +upstreamnt  +downstreamnt atgccggctgcagagctctgctctttttgtttggagaggtttgcgaccatgcctgatccg tctaagtcggcccccgcgcccaagaagggctccaagaaggccgtcaccaaggcgcagaag aaggacggcaagaagcgcaagcgcagccgcaaggagagctactccatctacgtgtacaag gtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatgggcatcatgaac tcgttcgtcaacgacatctttgagcgcatcgccagcgaggcctcccgcctggcgcattac aacaagcgctcgaccatcacgtcccgcgaggtgcagacggccgtgcgcctgctgctgccc ggcgagctggccaagcacgcggtgtccgagggcaccaaggccgtcaccaagtacaccagc tccaagtga

DBGET integrated database retrieval system