Canis lupus familiaris (dog): 483164 Help Entry 483164            CDS       T01007                                  Symbol H2BC18 Name (RefSeq) histone H2B type 2-F   KO K11252   histone H2B Organism cfa  Canis lupus familiaris (dog) Pathway cfa04613   Neutrophil extracellular trap formation cfa05034   Alcoholism cfa05203   Viral carcinogenesis cfa05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cfa00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     483164 (H2BC18)  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     483164 (H2BC18)   09163 Immune disease    05322 Systemic lupus erythematosus     483164 (H2BC18)   09165 Substance dependence    05034 Alcoholism     483164 (H2BC18)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cfa03036]     483164 (H2BC18)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfa04147]     483164 (H2BC18) Chromosome and associated proteins [BR:cfa03036]  Eukaryotic type   Nucleosome assembly factors    Histones     483164 (H2BC18) Exosome [BR:cfa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    483164 (H2BC18) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like Motif Other DBs NCBI-GeneID:  483164 NCBI-ProteinID:  XP_038309092 VGNC:  83701 LinkDB All DBs Position 17:complement(58566049..58569140) Genome browser AA seq 126 aa AA seqDB search MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgatccagcaaaatcggctcccgctcccaagaagggttccaaaaaggctgtcacg aaggtgcaaaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactccgtc tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgccggcgaggcctcccgc ctggcgcattacaacaagcgctccaccatcacctcccgggagatccagacggccgtgcgc ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagctccaagtaa

DBGET integrated database retrieval system