Canis lupus familiaris (dog): 483168 Help Entry 483168            CDS       T01007                                  Symbol H2AC19 Name (RefSeq) histone H2A type 2-A   KO K11251   histone H2A Organism cfa  Canis lupus familiaris (dog) Pathway cfa03082   ATP-dependent chromatin remodeling cfa04217   Necroptosis cfa04613   Neutrophil extracellular trap formation cfa05034   Alcoholism cfa05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cfa00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     483168 (H2AC19)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     483168 (H2AC19)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     483168 (H2AC19)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     483168 (H2AC19)   09165 Substance dependence    05034 Alcoholism     483168 (H2AC19)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cfa03036]     483168 (H2AC19)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfa04147]     483168 (H2AC19) Chromosome and associated proteins [BR:cfa03036]  Eukaryotic type   Nucleosome assembly factors    Histones     483168 (H2AC19) Exosome [BR:cfa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    483168 (H2AC19) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  483168 NCBI-ProteinID:  XP_540286 VGNC:  83704 UniProt:  A0A8C0MB26 LinkDB All DBs Position 17:complement(58594993..58595586) Genome browser AA seq 130 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHHKAKGK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgtggcaaacaaggaggcaaggcccgcgccaaggccaaatcgcgctcgtcc cgcgccggcctgcagttcccagtggggcgcgtgcaccggctgctgcgtaagggcaactac gccgagcgggtgggggccggcgctcccgtctacatggcggccgtgctggagtacctgacg gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgtatcatc ccccgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggcaag gtcaccatcgcccagggcggcgtcctgcccaacatccaggctgtgttgctccctaagaag acggagagccaccacaaggcgaagggcaagtga

DBGET integrated database retrieval system