Canis lupus familiaris (dog): 483680 Help Entry 483680            CDS       T01007                                  Symbol FGF4 Name (RefSeq) fibroblast growth factor 4   KO K04358   fibroblast growth factor Organism cfa  Canis lupus familiaris (dog) Pathway cfa04010   MAPK signaling pathway cfa04014   Ras signaling pathway cfa04015   Rap1 signaling pathway cfa04020   Calcium signaling pathway cfa04151   PI3K-Akt signaling pathway cfa04810   Regulation of actin cytoskeleton cfa05200   Pathways in cancer cfa05207   Chemical carcinogenesis - receptor activation cfa05218   Melanoma cfa05224   Breast cancer cfa05226   Gastric cancer Brite KEGG Orthology (KO) [BR:cfa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     483680 (FGF4)    04014 Ras signaling pathway     483680 (FGF4)    04015 Rap1 signaling pathway     483680 (FGF4)    04020 Calcium signaling pathway     483680 (FGF4)    04151 PI3K-Akt signaling pathway     483680 (FGF4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     483680 (FGF4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     483680 (FGF4)    05207 Chemical carcinogenesis - receptor activation     483680 (FGF4)   09162 Cancer: specific types    05226 Gastric cancer     483680 (FGF4)    05218 Melanoma     483680 (FGF4)    05224 Breast cancer     483680 (FGF4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cfa04052]     483680 (FGF4)    00536 Glycosaminoglycan binding proteins [BR:cfa00536]     483680 (FGF4) Cytokines and neuropeptides [BR:cfa04052]  Cytokines   Growth factors (RTK binding)    483680 (FGF4) Glycosaminoglycan binding proteins [BR:cfa00536]  Heparan sulfate / Heparin   Growth factors/receptors    483680 (FGF4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  483680 NCBI-ProteinID:  XP_540801 Ensembl:  ENSCAFG00000029983 VGNC:  40850 UniProt:  A0A8C0QMH2 J9P3I7 LinkDB All DBs Position 18:47023493..47027360 Genome browser AA seq 206 aa AA seqDB search MAGPGAAAAALLPAVLLAVLAPWAGRGGAAAPTAPNGTLGAELERRWESLVVRSLARLPV AAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQVLPDGRIGGVHADTSDSLLELSP VERGVVSIFGVASRFFVAMSSKGKLYGSPFFTEECKFKEILLPNNYNAYECYRYPGMFIA LSKNGKTKKGSRVSPTMKVTHFLPRL NT seq 621 nt NT seq  +upstreamnt  +downstreamnt atggcggggcccggggcggccgcggcggcgctgctcccggcggtcctgctggcggtgctg gcgccctgggccggccgcgggggcgccgccgcccccaccgcccccaacggcacgctgggc gccgagctggagcgccgctgggagagcctggtggtgcgctcgctggcgcgcctgccggtg gccgcgcagcccaaggaggcggccgtccagagcggcgccggcgactacctcctgggcatc aagcggctgcggcggctctactgcaacgtgggcatcggcttccacctccaggtgctcccc gacggccgcatcggcggcgtgcacgcggacacgagcgacagcctgctggagctctcgccg gtggagcggggcgtggtgagcatcttcggcgtggccagccggttcttcgtggccatgagc agcaagggcaagctgtacggctcgcccttcttcaccgaggagtgcaagttcaaagagatc ctgctccccaacaactacaatgcctacgagtgctacaggtacccgggcatgttcattgcc ctgagcaagaacgggaagaccaagaaagggagccgagtgtcccccaccatgaaggtcacc cacttcctccccaggctgtga

DBGET integrated database retrieval system