Canis lupus familiaris (dog): 486077 Help Entry 486077            CDS       T01007                                  Symbol CTSB Name (RefSeq) cathepsin B isoform X2   KO K01363   cathepsin B [EC:3.4.22.1] Organism cfa  Canis lupus familiaris (dog) Pathway cfa04140   Autophagy - animal cfa04142   Lysosome cfa04210   Apoptosis cfa04612   Antigen processing and presentation cfa04621   NOD-like receptor signaling pathway cfa04924   Renin secretion Brite KEGG Orthology (KO) [BR:cfa00001]  09140 Cellular Processes   09141 Transport and catabolism    04142 Lysosome     486077 (CTSB)    04140 Autophagy - animal     486077 (CTSB)   09143 Cell growth and death    04210 Apoptosis     486077 (CTSB)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     486077 (CTSB)    04612 Antigen processing and presentation     486077 (CTSB)   09152 Endocrine system    04924 Renin secretion     486077 (CTSB)  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:cfa01002]     486077 (CTSB)   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:cfa03110]     486077 (CTSB)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfa04147]     486077 (CTSB)    00536 Glycosaminoglycan binding proteins [BR:cfa00536]     486077 (CTSB) Enzymes [BR:cfa01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.22  Cysteine endopeptidases     3.4.22.1  cathepsin B      486077 (CTSB) Peptidases and inhibitors [BR:cfa01002]  Cysteine peptidases   Family C1: papain family    486077 (CTSB) Chaperones and folding catalysts [BR:cfa03110]  Intramolecular chaperones   Papain family    486077 (CTSB) Exosome [BR:cfa04147]  Exosomal proteins   Exosomal proteins of microglial cells    486077 (CTSB) Glycosaminoglycan binding proteins [BR:cfa00536]  Heparan sulfate / Heparin   Others    486077 (CTSB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Peptidase_C1 Peptidase_C1_2 Motif Other DBs NCBI-GeneID:  486077 NCBI-ProteinID:  XP_022265747 Ensembl:  ENSCAFG00000007934 VGNC:  39709 LinkDB All DBs Position 25:26693298..26713566 Genome browser AA seq 215 aa AA seqDB search MPANSGLTARPSKRSETRVPAVPAGCNGGFPAEAWNFWTKQGLVSGGLYDSHVGCRPYSI PPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPSYKEDKHYGCSSYSVSDNEKEIMAEIY KNGPVEAAFTVYSDFLLYKSGVYQHVTGEMMGGHAVRILGWGVEDGTPYWLVGNSWNTDW GDNGFFKILRGRDHCGIESEIVAGIPCTDQYWKKI NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgcccgcgaacagtggcctaactgcccgaccatcaaagagatccgagaccagggttcct gcggttcctgctggctgtaatggaggctttcctgctgaagcttggaacttctggacaaag caaggcctggtgtcggggggcctctatgactctcatgtgggctgcagaccctactccatc cctccctgtgagcaccacgtgaacggctcccggcccccatgcacaggggagggggatacc cccaagtgcagcaagatctgcgagcccggctactcgccgtcctacaaagaagacaaacac tacggatgcagttcctacagtgtgtccgataacgagaaggagatcatggcagagatctac aaaaacggcccggtggaggcggccttcaccgtgtactccgacttcctgctgtacaagtcc ggagtgtaccagcacgtcactggagagatgatgggaggccatgccgtccgtatcctgggc tggggagtggaggatggcacaccctactggctggttggcaactcctggaacactgactgg ggcgacaatggcttctttaaaatcctcagaggacgggatcactgtggaattgaatctgaa atcgtggctggaatcccatgtactgaccagtactggaaaaagatctaa

DBGET integrated database retrieval system