Canis lupus familiaris (dog): 488239 Help Entry 488239            CDS       T01007                                  Symbol E2F3 Name (RefSeq) transcription factor E2F3   KO K06620   transcription factor E2F3 Organism cfa  Canis lupus familiaris (dog) Pathway cfa01522   Endocrine resistance cfa04110   Cell cycle cfa04218   Cellular senescence cfa04934   Cushing syndrome cfa05160   Hepatitis C cfa05161   Hepatitis B cfa05163   Human cytomegalovirus infection cfa05166   Human T-cell leukemia virus 1 infection cfa05167   Kaposi sarcoma-associated herpesvirus infection cfa05169   Epstein-Barr virus infection cfa05200   Pathways in cancer cfa05206   MicroRNAs in cancer cfa05212   Pancreatic cancer cfa05214   Glioma cfa05215   Prostate cancer cfa05218   Melanoma cfa05219   Bladder cancer cfa05220   Chronic myeloid leukemia cfa05222   Small cell lung cancer cfa05223   Non-small cell lung cancer cfa05224   Breast cancer cfa05225   Hepatocellular carcinoma cfa05226   Gastric cancer Brite KEGG Orthology (KO) [BR:cfa00001]  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     488239 (E2F3)    04218 Cellular senescence     488239 (E2F3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     488239 (E2F3)    05206 MicroRNAs in cancer     488239 (E2F3)   09162 Cancer: specific types    05212 Pancreatic cancer     488239 (E2F3)    05225 Hepatocellular carcinoma     488239 (E2F3)    05226 Gastric cancer     488239 (E2F3)    05214 Glioma     488239 (E2F3)    05220 Chronic myeloid leukemia     488239 (E2F3)    05218 Melanoma     488239 (E2F3)    05219 Bladder cancer     488239 (E2F3)    05215 Prostate cancer     488239 (E2F3)    05224 Breast cancer     488239 (E2F3)    05222 Small cell lung cancer     488239 (E2F3)    05223 Non-small cell lung cancer     488239 (E2F3)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     488239 (E2F3)    05161 Hepatitis B     488239 (E2F3)    05160 Hepatitis C     488239 (E2F3)    05163 Human cytomegalovirus infection     488239 (E2F3)    05167 Kaposi sarcoma-associated herpesvirus infection     488239 (E2F3)    05169 Epstein-Barr virus infection     488239 (E2F3)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     488239 (E2F3)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     488239 (E2F3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:cfa03000]     488239 (E2F3) Transcription factors [BR:cfa03000]  Eukaryotic type   Helix-turn-helix    Fork head/winged helix cell cycle-controlling factors, E2F     488239 (E2F3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  E2F_CC-MB WHD_E2F_TDP Motif Other DBs NCBI-GeneID:  488239 NCBI-ProteinID:  XP_005640124 Ensembl:  ENSCAFG00000031036 VGNC:  40165 LinkDB All DBs Position 35:18971644..19045676 Genome browser AA seq 334 aa AA seqDB search MPLQQQAKRRLELGESGHQYLSDGLKTPKGKGRATLRSPDSPKKKTRYDTSLGLLTKKFI QLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQWMGCSLSEDGG MLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAYVTYQDIRKISGLK DQTVIVVKAPPETRLEVPDPIESLQIHLASTQGPIEVYLCPEETETHSPMKTTNQDHNGN IPKPPSKDLASTNSGHSDCSISMANLSPLASPANLLQQTEDQIPSNLEGPFVNLLPPLLQ EDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt atgcccttacagcagcaggcaaagcgaaggctggagctgggagaaagcggtcatcagtac ctctcagatggcttaaaaacccccaagggcaaaggaagagccacactgcgaagtccagat agtccaaaaaaaaaaacacggtatgacacatcacttggtctgctcaccaagaagttcatt cagctgctgagccagtcccctgatggggtcttggatttgaacaaggcagcggaggtgctg aaagtgcaaaagagaagaatctacgacatcaccaacgtgctggaaggcatccacctcatt aagaagaagtcgaaaaacaacgtgcagtggatgggctgcagtctgtctgaggatgggggc atgctggcccagtgtcaaggcctctcaaaggaagtgaccgagctcagccaggaagagaag aaattagatgaactgatccaaagctgcaccctggacctcaagctgctaaccgaggattca gagaatcaaaggttagcttatgttacatatcaagatattcgaaaaattagtggccttaaa gaccaaactgttatagttgtcaaagcccctccagaaacaagacttgaagtgcctgaccca atagagagcctacaaatacatttggcaagtacccaagggcccattgaggtttatttgtgt ccagaagagacagaaacacacagtccaatgaaaacaaccaaccaagaccacaatgggaat atcccgaaacccccttccaaagacttggcttcaaccaactcaggacatagcgattgttca atttctatggcaaacctttctcctttggcctccccagccaacctcttacagcagactgag gaccaaattccttccaacttagaaggaccatttgtgaacttactgcctcccctgctccaa gaagactatctcctaagccttggggaggaagaaggcatcagtgatctctttgatgcttat gatttggaaaagctcccactggtggaagactttatgtgtagttga

DBGET integrated database retrieval system