Canis lupus familiaris (dog): 488253 Help Entry 488253            CDS       T01007                                  Symbol H2BC2 Name (RefSeq) histone H2B type 1-A   KO K11252   histone H2B Organism cfa  Canis lupus familiaris (dog) Pathway cfa04613   Neutrophil extracellular trap formation cfa05034   Alcoholism cfa05203   Viral carcinogenesis cfa05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cfa00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     488253 (H2BC2)  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     488253 (H2BC2)   09163 Immune disease    05322 Systemic lupus erythematosus     488253 (H2BC2)   09165 Substance dependence    05034 Alcoholism     488253 (H2BC2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cfa03036]     488253 (H2BC2)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfa04147]     488253 (H2BC2) Chromosome and associated proteins [BR:cfa03036]  Eukaryotic type   Nucleosome assembly factors    Histones     488253 (H2BC2) Exosome [BR:cfa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    488253 (H2BC2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like CvfB_WH Motif Other DBs NCBI-GeneID:  488253 NCBI-ProteinID:  XP_022270208 Ensembl:  ENSCAFG00000029445 VGNC:  83714 UniProt:  A0A8C0P3X5 A0A8I3S4J6 LinkDB All DBs Position 35:complement(23593121..23593664) Genome browser AA seq 127 aa AA seqDB search MPELTSKGTTISKKGFKRAVAKTQKKEGKKRRRCRKESYSIYIYKVLKQVHPDTGISSKA MGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAV TKYTSSK NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgccggagctgacttcgaagggcactaccatctccaagaaaggcttcaagagagctgta gccaaaacccagaagaaagagggaaagaagcgcaggagatgccggaaagagagctattct atctacatctataaggtgctgaagcaggtgcaccccgacacgggcatctcgtccaaggcc atgggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcg cgcctggcgcattacaacaagcgctcgaccatcacgtccagggagatccagacggccgtg cgcctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtc accaagtacaccagctccaaataa

DBGET integrated database retrieval system