Canis lupus familiaris (dog): 488262 Help Entry 488262            CDS       T01007                                  Symbol H2AC5 Name (RefSeq) histone H2A type 1-E   KO K11251   histone H2A Organism cfa  Canis lupus familiaris (dog) Pathway cfa03082   ATP-dependent chromatin remodeling cfa04217   Necroptosis cfa04613   Neutrophil extracellular trap formation cfa05034   Alcoholism cfa05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cfa00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     488262 (H2AC5)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     488262 (H2AC5)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     488262 (H2AC5)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     488262 (H2AC5)   09165 Substance dependence    05034 Alcoholism     488262 (H2AC5)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cfa03036]     488262 (H2AC5)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfa04147]     488262 (H2AC5) Chromosome and associated proteins [BR:cfa03036]  Eukaryotic type   Nucleosome assembly factors    Histones     488262 (H2AC5) Exosome [BR:cfa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    488262 (H2AC5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  488262 NCBI-ProteinID:  XP_013966034 Ensembl:  ENSCAFG00000031754 VGNC:  83715 UniProt:  A0A8C0NV55 A0A5F4CIE3 LinkDB All DBs Position 35:23880312..23881611 Genome browser AA seq 130 aa AA seqDB search MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK TESHHKAKGK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtcgggtcggggaaagcagggcggcaaggctcgcgccaaggccaagacgcgctcgtcg cgggccgggctccagttcccggtgggccgcgtccaccgcctgctccgcaagggcaactac gcggagcgggtcggggcgggcgcgccggtgtacctggcggccgtgctggagtacctgacg gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgcatcatc ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggccgc gtgaccatcgcgcagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaag accgagagccaccacaaggccaaagggaagtaa

DBGET integrated database retrieval system