Canis lupus familiaris (dog): 488277 Help Entry 488277            CDS       T01007                                  Symbol H4C8 Name (RefSeq) H4 clustered histone 8   KO K11254   histone H4 Organism cfa  Canis lupus familiaris (dog) Pathway cfa04613   Neutrophil extracellular trap formation cfa05034   Alcoholism cfa05203   Viral carcinogenesis cfa05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cfa00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     488277 (H4C8)  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     488277 (H4C8)   09163 Immune disease    05322 Systemic lupus erythematosus     488277 (H4C8)   09165 Substance dependence    05034 Alcoholism     488277 (H4C8)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cfa03036]     488277 (H4C8) Chromosome and associated proteins [BR:cfa03036]  Eukaryotic type   Nucleosome assembly factors    Histones     488277 (H4C8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  488277 NCBI-ProteinID:  NP_001361509 VGNC:  84560 LinkDB All DBs Position 35:complement(24050722..24051252) Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcggcaagggcgggaagggactaggcaagggcggcgccaagcgccaccgc aaggtgctgcgcgacaacatccagggcatcaccaagcccgccatccggcggctggcccgg cgcggcggcgtcaagcgcatctcgggcctcatctacgaggagacccgcggggtgctcaag gtgttcctggagaacgtgatccgggacgccgtcacctacacggagcacgccaagcgcaag acggtcacggccatggacgtggtctatgcgctcaagcgccagggccgcaccctctacggc ttcggcggctga

DBGET integrated database retrieval system