Canis lupus familiaris (dog): 489091 Help Entry 489091            CDS       T01007                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism cfa  Canis lupus familiaris (dog) Pathway cfa04015   Rap1 signaling pathway cfa04810   Regulation of actin cytoskeleton cfa05014   Amyotrophic lateral sclerosis cfa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cfa00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     489091 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     489091 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     489091 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     489091 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cfa04131]     489091 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:cfa04812]     489091 (PFN3)    04147 Exosome [BR:cfa04147]     489091 (PFN3) Membrane trafficking [BR:cfa04131]  Others   Actin-binding proteins    Others     489091 (PFN3) Cytoskeleton proteins [BR:cfa04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      489091 (PFN3) Exosome [BR:cfa04147]  Exosomal proteins   Proteins found in most exosomes    489091 (PFN3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  489091 NCBI-ProteinID:  XP_013968463 VGNC:  44449 UniProt:  A0A8C0SP78 A0A8I3N5I2 LinkDB All DBs Position 4:35927059..35928149 Genome browser AA seq 137 aa AA seqDB search MGDWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRRTFL QAGLSIAGRRCCVLRDHLLSEGDGVLDARTKGLDGRAICVGHTPRVLLVLMGRRGAHGGI LNKTAHELINGLRTQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggagactggaaaggctatatcagcgcagtgctccgggaccagcgtattgacgacgtg gccatcgtgggccactcggacaatcgctgcgtgtgggcatcacgccctggcggccttctg gctgccatatccccgcaggaggtgggtgtgctcacagggcccgaccgccgcactttcctg caggcaggtctgagcattgcaggccgccgctgctgcgtcctccgtgaccacttgctgtct gagggcgatggcgttctggacgcacgcactaaggggctggatgggcgcgccatctgcgta ggccacaccccgcgcgtgctccttgtgcttatgggccgtcgtggcgcgcacggcggcatc ctcaataagacagcgcatgaactgatcaacgggctccgcacgcagggcacctag

DBGET integrated database retrieval system