Canis lupus familiaris (dog): 489466 Help Entry 489466            CDS       T01007                                  Symbol CLDN7 Name (RefSeq) claudin-7   KO K06087   claudin Organism cfa  Canis lupus familiaris (dog) Pathway cfa03272   Virion - Hepatitis viruses cfa04382   Cornified envelope formation cfa04514   Cell adhesion molecule (CAM) interaction cfa04530   Tight junction cfa04670   Leukocyte transendothelial migration cfa05160   Hepatitis C Brite KEGG Orthology (KO) [BR:cfa00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     489466 (CLDN7)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     489466 (CLDN7)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     489466 (CLDN7)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     489466 (CLDN7)   09158 Development and regeneration    04382 Cornified envelope formation     489466 (CLDN7)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     489466 (CLDN7)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cfa03037]     489466 (CLDN7)    04147 Exosome [BR:cfa04147]     489466 (CLDN7) Cilium and associated proteins [BR:cfa03037]  Other cilia and associated proteins   Stereociliary proteins    489466 (CLDN7) Exosome [BR:cfa04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    489466 (CLDN7)   Exosomal proteins of colorectal cancer cells    489466 (CLDN7) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Clc-like Motif Other DBs NCBI-GeneID:  489466 NCBI-ProteinID:  XP_546584 Ensembl:  ENSCAFG00000016124 VGNC:  53320 UniProt:  A0A8C0N749 A0A8I3PKL1 LinkDB All DBs Position 5:complement(32362233..32364044) Genome browser AA seq 211 aa AA seqDB search MANSGLQLLGFALALVGWAGLVASTAIPQWQMSSYAGDNIITAQAMYKGLWMECVTQSTG MMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTNCGGDDKVKKARIAM TGGIIFIVGGLAALVACSWYGHQIVTDFYNPLVPMNIKYEFGPAIFIGWAGSALVILGGA LLSCSCPGSESKAGYRAPRSYPKPNSAKEYV NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggccaactcgggcctgcagctgctgggcttcgccctggccctggtgggctgggcgggc ctggtggcgagcaccgccatcccgcagtggcagatgagctcgtacgcgggcgacaacatc atcacggcccaggccatgtacaaggggctgtggatggagtgcgtgacgcagagcaccggc atgatgagctgcaaaatgtacgactcggtgctggccctgtcggcggccttgcaggccacc cgtgccctgatggtggtgtccctggtgctgggattcctggccatgtttgtggccacgatg ggcatgaagtgtaccaactgtgggggagacgacaaagtgaagaaggcccgaatagctatg accggaggcatcattttcattgtgggaggtcttgctgccttggtagcctgctcctggtac ggccaccagattgtcacggacttctacaaccccctggtccccatgaatattaagtacgag tttggtcctgccatcttcattggctgggcagggtctgctctggtcattctgggaggtgcc ctgctctcttgctcctgtcctgggagcgagagcaaagctgggtaccgtgcaccccgctcc taccctaagcccaactctgccaaggagtacgtgtga

DBGET integrated database retrieval system