Canis lupus familiaris (dog): 489664 Help Entry 489664            CDS       T01007                                  Symbol CYBA Name (RefSeq) cytochrome b-245 alpha chain   KO K08009   cytochrome b-245, alpha polypeptide Organism cfa  Canis lupus familiaris (dog) Pathway cfa04145   Phagosome cfa04380   Osteoclast differentiation cfa04613   Neutrophil extracellular trap formation cfa04621   NOD-like receptor signaling pathway cfa04670   Leukocyte transendothelial migration cfa05020   Prion disease cfa05140   Leishmaniasis cfa05208   Chemical carcinogenesis - reactive oxygen species cfa05415   Diabetic cardiomyopathy cfa05417   Lipid and atherosclerosis cfa05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cfa00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     489664 (CYBA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     489664 (CYBA)    04621 NOD-like receptor signaling pathway     489664 (CYBA)    04670 Leukocyte transendothelial migration     489664 (CYBA)   09158 Development and regeneration    04380 Osteoclast differentiation     489664 (CYBA)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     489664 (CYBA)   09174 Infectious disease: parasitic    05140 Leishmaniasis     489664 (CYBA)   09164 Neurodegenerative disease    05020 Prion disease     489664 (CYBA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     489664 (CYBA)    05418 Fluid shear stress and atherosclerosis     489664 (CYBA)    05415 Diabetic cardiomyopathy     489664 (CYBA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cfa04131]     489664 (CYBA) Membrane trafficking [BR:cfa04131]  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     489664 (CYBA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_B558a DUF6030 Cg6151-P Motif Other DBs NCBI-GeneID:  489664 NCBI-ProteinID:  NP_001093760 Ensembl:  ENSCAFG00000019881 VGNC:  50284 UniProt:  A7E3M4 LinkDB All DBs Position 5:64703545..64711735 Genome browser AA seq 195 aa AA seqDB search MGQIEWAMWANEQALASGLILIMGGIVATAGQFTKWYFGAYSIGAGVFVCLLEYPRGKRR KGSTMERCGQKYMTKVVKVFGPLSRNYYIRAFLHLGLSVPAGFLLATILGTACLAIASSI YLLAAYHGEQWIPIEPQPKERPQVGGTIKQPPSNPPPRPPAEARKKPSEEEEAAGAVGVS GGPQENPVPVIDEVV NT seq 588 nt NT seq  +upstreamnt  +downstreamnt atggggcagatcgagtgggccatgtgggccaacgagcaggcgctggcgtccggcctgatc ctcatcatgggaggcatcgtggccaccgccggccagttcaccaagtggtacttcggcgcc tactccatcggagcaggcgtgtttgtgtgcctgctggagtatccgcgcgggaagaggagg aagggatccaccatggagagatgtggacagaagtacatgaccaaagtggtgaaggtgttc gggcctctctccaggaactactacatccgggccttcctgcaccttgggctctcagtacct gctggattcctgctggccaccatcctggggacagcctgcctggccatcgcgagcagcatc tatctgctggcggcttaccacggagagcagtggatccccatcgagccccagcccaaggag cgtccgcaggtgggtggcaccatcaagcagccgcccagcaaccccccaccgcggccgcca gccgaggcccggaagaagcccagtgaagaggaggaggcggcaggtgctgtgggggtttcc ggtggcccccaggaaaacccagtcccggtgattgatgaggttgtatga

DBGET integrated database retrieval system