KEGG   Canis lupus familiaris (dog): 489929
Entry
489929            CDS       T01007                                 
Symbol
ITGAX
Name
(RefSeq) integrin alpha-X isoform X2
  KO
K06462  integrin alpha X
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04610  Complement and coagulation cascades
cfa04810  Regulation of actin cytoskeleton
cfa05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    489929 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    489929 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    489929 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:cfa04515]
    489929 (ITGAX)
   04090 CD molecules [BR:cfa04090]
    489929 (ITGAX)
Cell adhesion molecules [BR:cfa04515]
 Integrins
  Integrin alpha subunits
   489929 (ITGAX)
CD molecules [BR:cfa04090]
 Proteins
  489929 (ITGAX)
SSDB
Motif
Pfam: Integrin_alpha2 Integrin_alpha
Other DBs
NCBI-GeneID: 489929
NCBI-ProteinID: XP_038400113
Ensembl: ENSCAFG00000016881
VGNC: 42135
LinkDB
Position
6:complement(18487797..18499807), 6:22643925..22660443
AA seq 410 aa
MLAVDAQRYFTASLPFEKNCGTDHVCQDDLGISFNFSGLQTLVVGSTLELNMNVMVWNDG
EDSYGTTVTFFYPPGLSYRRVVESKSQLQPHSPRLTCDGVPAQGQGTQSTRCSINHLILR
EGAQITFTVTFDVSPKAMLGDRLLLTANVSSENNTPRTSKSTFQLELVVKYAIYTVISSH
EQSTKYLNFSASDQEKSSQAHHRYQVNNLGQRDLPISINFSVPVELNGMPVWTNLEVFHP
QNPSIQCSLERTVHTESDFLTHIQKNSVVNCSIADCMRFHCDFPSFGIQEELDFILKGNL
SFGWVSQTLQKKVLVVSVAEITFNRSVYSQIPGQEAFLTAQVETVLEKYEVYNPIPIIVG
SSVGGLLLLALITAILYKAGFFKRQYKEMMAEANGQIAPENGTSDPQVAQ
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgttggctgtggatgctcagagatacttcacagcctctctcccctttgagaagaattgt
ggaactgaccatgtctgccaggatgaccttggcatttcctttaacttctcaggattgcag
accctggtggtggggagtaccctggagctgaacatgaatgtgatggtgtggaatgatggt
gaggactcctatggaaccacagtcaccttcttctacccaccagggctgtcttatcgacgt
gtggtagagagcaagagccagctacagccacactccccacgcctgacctgtgatggcgtc
ccagcccagggccagggtactcagagcacccgctgcagcatcaaccacctcatcctccgt
gaaggtgcccagatcaccttcacagtcacatttgacgtctctcccaaggccatgctggga
gaccggttgcttctgacagctaatgtgagcagtgaaaataacactcccaggaccagcaag
agcacctttcagttggagctcgtggtgaagtatgccatctacaccgtgatcagcagccac
gaacagtccactaagtacctcaacttctcagcctcagaccaggagaaaagcagccaggct
caccatagataccaggtcaacaacctgggacagagggacctgcctatcagcatcaatttc
tctgtgcctgtggagctgaatgggatgcctgtgtggacgaacttagaggtcttccacccc
cagaacccatccattcagtgctctttagagagaacagtgcacacagagtctgacttcctg
acccacattcagaagaattctgtggtgaactgctccattgctgactgcatgaggttccac
tgtgatttcccctcctttggcatccaggaggaacttgacttcattctgaagggcaacctc
agctttggttgggtcagccagacattgcagaagaaggtattggtcgtgagtgtggctgaa
atcacattcaacagatctgtgtattcccagattccaggacaagaggcattcttgacagct
caggtggagacggtactggagaagtatgaggtctacaaccccatccccattattgtcgga
agctctgtgggaggactgctgctgttggctctcatcacagccatcctgtacaaggctggc
ttcttcaaacgtcagtataaggaaatgatggcagaagcaaacggacagattgccccagaa
aatgggacatcagatcctcaagttgcccaataa

DBGET integrated database retrieval system