Canis lupus familiaris (dog): 607073 Help Entry 607073            CDS       T01007                                  Symbol ARF4 Name (RefSeq) ADP-ribosylation factor 4   KO K07939   ADP-ribosylation factor 4 Organism cfa  Canis lupus familiaris (dog) Pathway cfa04144   Endocytosis Brite KEGG Orthology (KO) [BR:cfa00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     607073 (ARF4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cfa04131]     607073 (ARF4)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfa04147]     607073 (ARF4)    04031 GTP-binding proteins [BR:cfa04031]     607073 (ARF4) Membrane trafficking [BR:cfa04131]  Endosome - Golgi transport   Arf GTPases and associated proteins    Arf GTPases     607073 (ARF4) Exosome [BR:cfa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    607073 (ARF4)   Exosomal proteins of other body fluids (saliva and urine)    607073 (ARF4)   Exosomal proteins of colorectal cancer cells    607073 (ARF4) GTP-binding proteins [BR:cfa04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     607073 (ARF4) SSDB OrthologParalogGFIT Motif Pfam:  Arf SRPRB Roc Ras G-alpha Gtr1_RagA MMR_HSR1 6PF2K GTP_EFTU Motif Other DBs NCBI-GeneID:  607073 NCBI-ProteinID:  XP_849047 Ensembl:  ENSCAFG00000029086 VGNC:  38030 UniProt:  A0A8I3PMI1 LinkDB All DBs Position 20 Genome browser AA seq 180 aa AA seqDB search MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN ICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIQEGAEELQKMLQEDELRDAV LLLFANKQDLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR NT seq 543 nt NT seq  +upstreamnt  +downstreamnt atgggcctcaccatctcctccctcttctcccgcctcttcggcaagaagcagatgcgcatt ttgatggttggattggatgctgctggcaagacgaccattctgtataaactgaagttaggg gagatagtcaccaccattcctaccattggttttaatgtggaaacagtagaatataagaac atttgtttcacagtatgggatgttggtggtcaagataaaattaggcctctctggaggcat tacttccaaaatacccagggtcttatttttgtggtagatagtaatgatcgtgaaagaatt caggagggagctgaagaactgcagaaaatgcttcaggaagatgagttgagagatgcagtg ttgctgctttttgcgaacaaacaggatttgccaaatgctatggccatcagtgaaatgaca gataaattaggtcttcagtctcttcgtaacagaacatggtatgttcaagccacttgtgct acacaaggaactggtctgtatgagggacttgactggctgtcaaatgagctttcaaaacgt taa

DBGET integrated database retrieval system