Canis lupus familiaris (dog): 607397 Help Entry 607397            CDS       T01007                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism cfa  Canis lupus familiaris (dog) Pathway cfa04015   Rap1 signaling pathway cfa04810   Regulation of actin cytoskeleton cfa05014   Amyotrophic lateral sclerosis cfa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cfa00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     607397 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     607397 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     607397 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     607397 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cfa04131]     607397 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:cfa04812]     607397 (PFN1)    04147 Exosome [BR:cfa04147]     607397 (PFN1) Membrane trafficking [BR:cfa04131]  Others   Actin-binding proteins    Others     607397 (PFN1) Cytoskeleton proteins [BR:cfa04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      607397 (PFN1) Exosome [BR:cfa04147]  Exosomal proteins   Proteins found in most exosomes    607397 (PFN1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  607397 NCBI-ProteinID:  XP_038370003 VGNC:  53432 UniProt:  A0A8C0PGH0 A0A8I3MSY8 LinkDB All DBs Position 5:31807352..31810011 Genome browser AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSSGGAPTFNITVTMTAKTLVLLMGKEGVH GGMINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggctggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg gccatcgtgggctataaggactcgccctccgtgtgggccgccgtccccgggaagaccttc gtcaacatcacgccagctgaggtcggtgtcctggttggcaaagaccggtcgagttttttc gtgaacgggctgacactgggaggccagaagtgttctgtgatccgggactcgctgctgcag gatggggagtttactatggaccttcgtaccaagagcagcggtggagcgcccactttcaac atcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac ggtggtatgatcaacaagaaatgttatgaaatggcttcccacctgcggcgttcccagtac tga

DBGET integrated database retrieval system