Canis lupus familiaris (dog): 608207 Help Entry 608207            CDS       T01007                                  Symbol CLDN1 Name (RefSeq) claudin-1   KO K06087   claudin Organism cfa  Canis lupus familiaris (dog) Pathway cfa03272   Virion - Hepatitis viruses cfa04382   Cornified envelope formation cfa04514   Cell adhesion molecules cfa04530   Tight junction cfa04670   Leukocyte transendothelial migration cfa05160   Hepatitis C Brite KEGG Orthology (KO) [BR:cfa00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     608207 (CLDN1)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     608207 (CLDN1)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     608207 (CLDN1)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     608207 (CLDN1)   09158 Development and regeneration    04382 Cornified envelope formation     608207 (CLDN1)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     608207 (CLDN1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cfa03037]     608207 (CLDN1)    04147 Exosome [BR:cfa04147]     608207 (CLDN1)    04515 Cell adhesion molecules [BR:cfa04515]     608207 (CLDN1) Cilium and associated proteins [BR:cfa03037]  Other cilia and associated proteins   Stereociliary proteins    608207 (CLDN1) Exosome [BR:cfa04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    608207 (CLDN1)   Exosomal proteins of colorectal cancer cells    608207 (CLDN1) Cell adhesion molecules [BR:cfa04515]  Immunoglobulin superfamily   L1 family    608207 (CLDN1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Voltage_CLC SUR7 HAAS_TM DUF4134 DUF2613 Cytochrom_B_C DUF2207_C TMEM174 CD20 Motif Other DBs NCBI-GeneID:  608207 NCBI-ProteinID:  XP_850248 Ensembl:  ENSCAFG00000029313 VGNC:  39308 UniProt:  A0A8C0T9W5 A0A8I3PHM6 LinkDB All DBs Position 34:complement(26396629..26412654) Genome browser AA seq 211 aa AA seqDB search MANAGLQLLGFLLAFLGWVGSIVSTALPQWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTG QIQCKVFDSLLNLNSTLQATRALMVIGILLGLIAIFVATIGMKCMKCMEDDEVQKMRMAV IGGVIFLIAGLAVLVATAWYGNRIVQDFYDPMTPVNARYEFGQALFTGWAAASLCLLGGA LLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggccaacgcggggctgcagctcctgggcttcctgctggccttcctgggctgggtgggc tccatcgtcagcacggcgctgccccagtggaagatctactcgtacgccggcgacaacatc gtgacggcccaggccatctacgaggggctgtggatgtcctgcgtgtcgcagagcaccggg cagattcagtgcaaggtcttcgactcgctgctgaatctgaacagtactttgcaagcaacc cgtgctttgatggtgattggtatcctgctgggacttatagccatctttgtggccactatt ggcatgaagtgtatgaagtgcatggaagacgatgaggtgcagaagatgcggatggctgtc attgggggagtgatatttcttattgcaggtctggctgttttagttgccacagcatggtat ggcaatagaattgttcaagatttttatgaccctatgaccccggtcaatgccaggtatgaa tttggtcaggctctcttcactggctgggctgctgcctctctctgccttctgggaggtgcc ctgctttgctgctcctgtccccgaaaaacaacatcttacccaacaccacggccctatcca aaacctgcgccttccagtgggaaagactacgtgtga

DBGET integrated database retrieval system