Canis lupus familiaris (dog): 608218 Help Entry 608218            CDS       T01007                                  Symbol CLDN16 Name (RefSeq) claudin-16 isoform X2   KO K06087   claudin Organism cfa  Canis lupus familiaris (dog) Pathway cfa03272   Virion - Hepatitis viruses cfa04382   Cornified envelope formation cfa04514   Cell adhesion molecule (CAM) interaction cfa04530   Tight junction cfa04670   Leukocyte transendothelial migration cfa05160   Hepatitis C Brite KEGG Orthology (KO) [BR:cfa00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     608218 (CLDN16)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     608218 (CLDN16)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     608218 (CLDN16)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     608218 (CLDN16)   09158 Development and regeneration    04382 Cornified envelope formation     608218 (CLDN16)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     608218 (CLDN16)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cfa03037]     608218 (CLDN16)    04147 Exosome [BR:cfa04147]     608218 (CLDN16) Cilium and associated proteins [BR:cfa03037]  Other cilia and associated proteins   Stereociliary proteins    608218 (CLDN16) Exosome [BR:cfa04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    608218 (CLDN16)   Exosomal proteins of colorectal cancer cells    608218 (CLDN16) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Clc-like DUF1118 DuoxA Motif Other DBs NCBI-GeneID:  608218 NCBI-ProteinID:  XP_038318734 VGNC:  39312 LinkDB All DBs Position 34:26433682..26507764 Genome browser AA seq 222 aa AA seqDB search MRGLLQYTACFFAFFSTGFLVVATWTDCWMVNADDSLEVSTKCRGLWWECVTNAFDGIRT CDEYDSILAEHPHILAGFGFITLLLGLDCVKFLPDEPYIKVRICFVAGTMLLIAGAPGII GSVWYAVDVYVERSSLVLHNIFLGIQYKFGWSCWLGMAGSLGCFLAGAVLTCCLYLFKDV GLERNYPYSMRKAYSTAAASMAKSYAAPRTETAKMYAVDTRV NT seq 669 nt NT seq  +upstreamnt  +downstreamnt atgagaggtcttctccagtacaccgcctgcttctttgcctttttctctactgggttcttg gtcgtggccacctggacagactgttggatggtgaatgctgacgattccctggaggtgagc acaaaatgccgaggcctctggtgggagtgtgtcacgaatgcttttgatgggattcgcacc tgtgatgagtacgattctatacttgccgaacacccccatattctagctggatttggattc atcaccctgcttcttggtctcgactgtgtgaaattcctccctgatgagccatacatcaaa gtccgcatctgctttgttgctggaaccatgttactaatagcaggtgccccgggaatcatt ggttcagtgtggtatgcggttgatgtttatgtggaacgttcttctttggttttgcacaat atatttcttggcatccaatataaatttggttggtcttgttggcttggaatggctgggtct ctgggttgctttttggctggtgctgtcctgacatgctgcttatacctcttcaaagatgtt ggacttgagaggaattatccatattccatgaggaaagcctattcaacagcagctgcttcc atggccaagtcatatgcagcccctcgaacagagaccgccaaaatgtatgctgtggacacg agggtgtaa

DBGET integrated database retrieval system