Canis lupus familiaris (dog): 608549 Help Entry 608549            CDS       T01007                                  Symbol URM1 Name (RefSeq) ubiquitin-related modifier 1   KO K12161   ubiquitin related modifier 1 Organism cfa  Canis lupus familiaris (dog) Pathway cfa04122   Sulfur relay system Brite KEGG Orthology (KO) [BR:cfa00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04122 Sulfur relay system     608549 (URM1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:cfa03016]     608549 (URM1)    04121 Ubiquitin system [BR:cfa04121]     608549 (URM1) Transfer RNA biogenesis [BR:cfa03016]  Eukaryotic type   tRNA modification factors    Thiolation factors     608549 (URM1) Ubiquitin system [BR:cfa04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    608549 (URM1) SSDB OrthologParalogGFIT Motif Pfam:  Urm1 ThiS Motif Other DBs NCBI-GeneID:  608549 NCBI-ProteinID:  XP_850726 Ensembl:  ENSCAFG00000023618 VGNC:  48167 UniProt:  A0A8C0N9X7 A0A8I3PZA2 LinkDB All DBs Position 9 Genome browser AA seq 101 aa AA seqDB search MAAPLSVEVEFGGGAELLFDGVKKHQVTLPGQEEPWDIRSLLVWIKKNLLKERPELFIQG DSVRPGILVLVNDADWELLGELDYQLQDQDSILFISTLHGG NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggcggcgcccttgtcagtggaggtggagttcggaggcggtgcagagctcctgtttgat ggcgtaaagaaacatcaggtcaccttgcctggacaggaggagccctgggacatccggagt ctccttgtctggatcaagaagaatttgctaaaagagcggccagagttgttcatccaggga gacagcgtgcgaccaggaattctggtgctggttaacgatgccgactgggaactgctgggc gagctggactaccagctgcaggaccaggacagcatcctcttcatatccacactgcatggc ggctga

DBGET integrated database retrieval system