Canis lupus familiaris (dog): 609429 Help Entry 609429            CDS       T01007                                  Symbol JUN Name (RefSeq) transcription factor AP-1   KO K04448   transcription factor AP-1 Organism cfa  Canis lupus familiaris (dog) Pathway cfa01522   Endocrine resistance cfa04010   MAPK signaling pathway cfa04012   ErbB signaling pathway cfa04024   cAMP signaling pathway cfa04137   Mitophagy - animal cfa04210   Apoptosis cfa04310   Wnt signaling pathway cfa04380   Osteoclast differentiation cfa04510   Focal adhesion cfa04530   Tight junction cfa04620   Toll-like receptor signaling pathway cfa04621   NOD-like receptor signaling pathway cfa04625   C-type lectin receptor signaling pathway cfa04657   IL-17 signaling pathway cfa04658   Th1 and Th2 cell differentiation cfa04659   Th17 cell differentiation cfa04660   T cell receptor signaling pathway cfa04662   B cell receptor signaling pathway cfa04668   TNF signaling pathway cfa04722   Neurotrophin signaling pathway cfa04912   GnRH signaling pathway cfa04915   Estrogen signaling pathway cfa04921   Oxytocin signaling pathway cfa04926   Relaxin signaling pathway cfa04932   Non-alcoholic fatty liver disease cfa04933   AGE-RAGE signaling pathway in diabetic complications cfa05030   Cocaine addiction cfa05031   Amphetamine addiction cfa05132   Salmonella infection cfa05133   Pertussis cfa05135   Yersinia infection cfa05140   Leishmaniasis cfa05142   Chagas disease cfa05161   Hepatitis B cfa05162   Measles cfa05166   Human T-cell leukemia virus 1 infection cfa05167   Kaposi sarcoma-associated herpesvirus infection cfa05169   Epstein-Barr virus infection cfa05170   Human immunodeficiency virus 1 infection cfa05171   Coronavirus disease - COVID-19 cfa05200   Pathways in cancer cfa05203   Viral carcinogenesis cfa05207   Chemical carcinogenesis - receptor activation cfa05208   Chemical carcinogenesis - reactive oxygen species cfa05210   Colorectal cancer cfa05211   Renal cell carcinoma cfa05224   Breast cancer cfa05231   Choline metabolism in cancer cfa05235   PD-L1 expression and PD-1 checkpoint pathway in cancer cfa05321   Inflammatory bowel disease cfa05323   Rheumatoid arthritis cfa05417   Lipid and atherosclerosis cfa05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cfa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     609429 (JUN)    04012 ErbB signaling pathway     609429 (JUN)    04310 Wnt signaling pathway     609429 (JUN)    04668 TNF signaling pathway     609429 (JUN)    04024 cAMP signaling pathway     609429 (JUN)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     609429 (JUN)   09143 Cell growth and death    04210 Apoptosis     609429 (JUN)   09144 Cellular community - eukaryotes    04510 Focal adhesion     609429 (JUN)    04530 Tight junction     609429 (JUN)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     609429 (JUN)    04621 NOD-like receptor signaling pathway     609429 (JUN)    04625 C-type lectin receptor signaling pathway     609429 (JUN)    04660 T cell receptor signaling pathway     609429 (JUN)    04658 Th1 and Th2 cell differentiation     609429 (JUN)    04659 Th17 cell differentiation     609429 (JUN)    04657 IL-17 signaling pathway     609429 (JUN)    04662 B cell receptor signaling pathway     609429 (JUN)   09152 Endocrine system    04912 GnRH signaling pathway     609429 (JUN)    04915 Estrogen signaling pathway     609429 (JUN)    04921 Oxytocin signaling pathway     609429 (JUN)    04926 Relaxin signaling pathway     609429 (JUN)   09156 Nervous system    04722 Neurotrophin signaling pathway     609429 (JUN)   09158 Development and regeneration    04380 Osteoclast differentiation     609429 (JUN)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     609429 (JUN)    05207 Chemical carcinogenesis - receptor activation     609429 (JUN)    05208 Chemical carcinogenesis - reactive oxygen species     609429 (JUN)    05203 Viral carcinogenesis     609429 (JUN)    05231 Choline metabolism in cancer     609429 (JUN)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     609429 (JUN)   09162 Cancer: specific types    05210 Colorectal cancer     609429 (JUN)    05211 Renal cell carcinoma     609429 (JUN)    05224 Breast cancer     609429 (JUN)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     609429 (JUN)    05170 Human immunodeficiency virus 1 infection     609429 (JUN)    05161 Hepatitis B     609429 (JUN)    05171 Coronavirus disease - COVID-19     609429 (JUN)    05162 Measles     609429 (JUN)    05167 Kaposi sarcoma-associated herpesvirus infection     609429 (JUN)    05169 Epstein-Barr virus infection     609429 (JUN)   09171 Infectious disease: bacterial    05132 Salmonella infection     609429 (JUN)    05135 Yersinia infection     609429 (JUN)    05133 Pertussis     609429 (JUN)   09174 Infectious disease: parasitic    05140 Leishmaniasis     609429 (JUN)    05142 Chagas disease     609429 (JUN)   09163 Immune disease    05323 Rheumatoid arthritis     609429 (JUN)    05321 Inflammatory bowel disease     609429 (JUN)   09165 Substance dependence    05030 Cocaine addiction     609429 (JUN)    05031 Amphetamine addiction     609429 (JUN)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     609429 (JUN)    05418 Fluid shear stress and atherosclerosis     609429 (JUN)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     609429 (JUN)    04933 AGE-RAGE signaling pathway in diabetic complications     609429 (JUN)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     609429 (JUN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:cfa03000]     609429 (JUN) Transcription factors [BR:cfa03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     609429 (JUN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 ZapB PspA_IM30 TFIIA Fib_alpha DUF2859 DUF3450 FlaC_arch Motif Other DBs NCBI-GeneID:  609429 NCBI-ProteinID:  XP_005620302 VGNC:  42197 UniProt:  A0A8C0Z0Z1 LinkDB All DBs Position 5:51033459..51034786 Genome browser AA seq 341 aa AA seqDB search MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGMVAPAVASAAGGGGGGGGFSAGLHSEPPVYANLSNFNPG ALSSGGGAPSYGAAGLAFPAQPQQQQQQQQPQQPPQAPHHLPQQLPVQHPRLQALKEEPQ TVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQ NSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctgcag tccgagagcggcgcctacggctacagtaaccccaagatcctgaagcagagcatgaccctg aacctggccgacccggtgggcagcctgaagccgcacctccgggccaagaactcggacctg ctcacctcgcccgacgtggggctgctcaagctggcctcgcccgagctggagcgcctgatc atccagtccagcaacgggcacatcaccaccacgccgacccccacgcagttcctgtgcccc aagaacgtgacggacgagcaggagggcttcgccgagggcttcgtgcgcgccctggccgag ctgcacagccagaacacgctgcccagcgtcacgtcggcggcgcagccggtcagcggcgcg ggcatggtggccccggcggtggcctccgcggcgggcggcggcggcggcggcggcggcttc agcgcgggcctgcacagcgagccgccggtctacgccaacctcagcaacttcaacccgggc gcgctgagcagcggcggcggggcgccctcctacggcgcggccggcctggcctttcccgcg cagccccagcagcagcagcagcagcagcagccgcagcagcccccgcaagcgccgcaccac ctgccccagcagctccccgtgcagcacccgcgcctgcaggccctgaaggaggagccgcag acggtgcccgagatgcccggggagacgccgcccctgtcccccatcgacatggagtcgcaa gagaggatcaaggccgagaggaagcgcatgaggaaccgcatagctgcctccaagtgccgg aaaaggaagctggagaggatcgcccggctggaggaaaaagtgaaaaccttgaaagcgcag aactcggagctggcgtccacggccaacatgctcagggaacaggtggcacagcttaaacag aaagtcatgaatcacgttaacagtgggtgccagctcatgctaacgcagcagttgcaaacg ttttga

DBGET integrated database retrieval system