Canis lupus familiaris (dog): 609547 Help Entry 609547            CDS       T01007                                  Symbol CCK Name (RefSeq) cholecystokinins   KO K05226   cholecystokinin Organism cfa  Canis lupus familiaris (dog) Pathway cfa04080   Neuroactive ligand-receptor interaction cfa04081   Hormone signaling cfa04911   Insulin secretion cfa04972   Pancreatic secretion Brite KEGG Orthology (KO) [BR:cfa00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     609547 (CCK)    04081 Hormone signaling     609547 (CCK)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     609547 (CCK)   09154 Digestive system    04972 Pancreatic secretion     609547 (CCK)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cfa04052]     609547 (CCK) Cytokines and neuropeptides [BR:cfa04052]  Neuropeptides   GPCR binding    609547 (CCK) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Gastrin Metal_resist Motif Other DBs NCBI-GeneID:  609547 NCBI-ProteinID:  XP_851915 Ensembl:  ENSCAFG00000005246 VGNC:  52865 UniProt:  A0A8C0NBZ7 A0A8I3S0Y6 LinkDB All DBs Position 23:complement(11451726..11457488) Genome browser AA seq 114 aa AA seqDB search MNGGVCLCVLLAVLAAGALAQPVPADPAGPGAQREDEAPRRQLRAVQKVDGEPRAHLGAL LARYIQQARKAPSGRMSVIKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgaacggcggcgtgtgcctgtgcgtgctgctggcggtactggcggcgggcgccctggcg cagcccgtcccggccgacccggcgggcccgggggcgcagcgggaggacgaggcgccccgg aggcagctgagggcagtgcagaaggtggacggcgagccccgcgcgcacctgggcgccctg ctggccaggtacatccagcaggcccggaaagctccttctggccgaatgtccgtcattaag aacctgcagaacctggaccccagtcacaggataagcgaccgggactacatgggctggatg gattttggccggcgtagtgctgaggagtatgaatacccctcctaa

DBGET integrated database retrieval system