Canis lupus familiaris (dog): 610169 Help Entry 610169            CDS       T01007                                  Symbol NPPC Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism cfa  Canis lupus familiaris (dog) Pathway cfa04022   cGMP-PKG signaling pathway cfa04270   Vascular smooth muscle contraction cfa05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cfa00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     610169 (NPPC)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     610169 (NPPC)  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     610169 (NPPC)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cfa04052]     610169 (NPPC) Cytokines and neuropeptides [BR:cfa04052]  Neuropeptides   Neuropeptides (Unclassified)    610169 (NPPC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  610169 NCBI-ProteinID:  XP_852684 Ensembl:  ENSCAFG00000011135 VGNC:  43927 UniProt:  A0A8C0NT34 A0A8I3Q3C1 LinkDB All DBs Position 25:complement(44207480..44212095) Genome browser AA seq 126 aa AA seqDB search MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPGEELAEPQAAGGGQKKGDKTPGGG GANLKGDRSRLLRDLRVDTKSRAAWVRLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGS MSGLGC NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcacctctcgcagctgctggcctgcgccctgctgctcacgctactctcgctccggccc tccgaagccaagcccggggcaccgccgaaggtcccgcgaactccgcccggggaggagctg gccgagccccaggctgcggggggcggtcagaagaagggcgacaaaactcccgggggcggc ggcgccaacctcaagggcgaccggtcgcgactgctccgggacctgcgcgtggacaccaag tcgcgggccgcgtgggtgcgcctcctgcatgagcaccccaacgcgcgcaaatacaaagga ggcaacaagaagggtttgtccaagggctgcttcggcctcaagctggaccggatcggctcc atgagcggcttgggatgttag

DBGET integrated database retrieval system