Canis lupus familiaris (dog): 610829 Help Entry 610829            CDS       T01007                                  Symbol PFN4 Name (RefSeq) profilin-4 isoform X5   KO K05759   profilin Organism cfa  Canis lupus familiaris (dog) Pathway cfa04015   Rap1 signaling pathway cfa04810   Regulation of actin cytoskeleton cfa05014   Amyotrophic lateral sclerosis cfa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cfa00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     610829 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     610829 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     610829 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     610829 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cfa04131]     610829 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:cfa04812]     610829 (PFN4)    04147 Exosome [BR:cfa04147]     610829 (PFN4) Membrane trafficking [BR:cfa04131]  Others   Actin-binding proteins    Others     610829 (PFN4) Cytoskeleton proteins [BR:cfa04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      610829 (PFN4) Exosome [BR:cfa04147]  Exosomal proteins   Proteins found in most exosomes    610829 (PFN4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  610829 NCBI-ProteinID:  XP_005630240 Ensembl:  ENSCAFG00000031185 VGNC:  44450 UniProt:  A0A8C0NUW6 A0A8I3PDC3 LinkDB All DBs Position 17:complement(18469095..18477470) Genome browser AA seq 129 aa AA seqDB search MSHLQNLLLDTLLGTKHVDSAALIKLQERSLCVASPGFSVMPGDVRTLVNGFAKNPLQTR REGLYFKEKDYKCIRADDYSLYAKNEKTGVVVVKTHLYLLVATYTEGMYPSVCVEATEKL GEYLRRKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagtcatttgcagaacttactgttagataccctcctgggaacaaagcatgtggacagt gcagcactcatcaaactccaggagcgaagcttgtgtgtggcatcgccaggatttagtgta atgcctggtgatgtccgaacacttgtgaatggattcgccaagaaccctttacaaaccaga agagaaggattgtatttcaaggaaaaggattacaaatgtatccgggcagatgactattct ctttatgctaagaatgaaaaaactggtgtggtggttgtgaagacccatctatatcttctg gtggcaacttacaccgaaggcatgtatcctagtgtttgtgtggaagccacagagaagcta ggagaatatctaagaagaaaaggaaattaa

DBGET integrated database retrieval system