Canis lupus familiaris (dog): 611231 Help Entry 611231            CDS       T01007                                  Symbol H2AC14 Name (RefSeq) histone H2A type 1-H isoform X3   KO K11251   histone H2A Organism cfa  Canis lupus familiaris (dog) Pathway cfa03082   ATP-dependent chromatin remodeling cfa04217   Necroptosis cfa04613   Neutrophil extracellular trap formation cfa05034   Alcoholism cfa05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cfa00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     611231 (H2AC14)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     611231 (H2AC14)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     611231 (H2AC14)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     611231 (H2AC14)   09165 Substance dependence    05034 Alcoholism     611231 (H2AC14)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cfa03036]     611231 (H2AC14)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfa04147]     611231 (H2AC14) Chromosome and associated proteins [BR:cfa03036]  Eukaryotic type   Nucleosome assembly factors    Histones     611231 (H2AC14) Exosome [BR:cfa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    611231 (H2AC14) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  611231 NCBI-ProteinID:  XP_022270324 Ensembl:  ENSCAFG00000029078 VGNC:  83742 UniProt:  A0A8C0S358 A0A8I3NUT4 LinkDB All DBs Position 35:complement(24860836..24861888) Genome browser AA seq 128 aa AA seqDB search MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHHKAK NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgtcgggacgcgggaagcagggcggcaaggctcgcgccaaggccaagacgcgctcgtcg cgggccgggctccagttcccggtgggccgcgtccaccgcctgctccgcaagggcaactac gcggagcgggtcggggcgggcgcgccggtgtacctggcggccgtgctggagtacctgacg gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgcatcatc ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggcaaa gtcaccatcgcgcagggcggcgtcttgcccaacatccaggccgtgctgctgcccaagaag accgagagccaccacaaagccaaatga

DBGET integrated database retrieval system