Canis lupus familiaris (dog): 612779 Help Entry 612779            CDS       T01007                                  Name (RefSeq) histone H3.3A-like   KO K11253   histone H3 Organism cfa  Canis lupus familiaris (dog) Pathway cfa04613   Neutrophil extracellular trap formation cfa05034   Alcoholism cfa05202   Transcriptional misregulation in cancer cfa05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cfa00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     612779  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     612779   09163 Immune disease    05322 Systemic lupus erythematosus     612779   09165 Substance dependence    05034 Alcoholism     612779  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cfa03036]     612779   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfa04147]     612779 Chromosome and associated proteins [BR:cfa03036]  Eukaryotic type   Nucleosome assembly factors    Histones     612779 Exosome [BR:cfa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    612779 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone PAF CENP-T_C CBFD_NFYB_HMF CENP-S DUF4840 Motif Other DBs NCBI-GeneID:  612779 NCBI-ProteinID:  XP_003432554 Ensembl:  ENSCAFG00000011517 UniProt:  A0A8C0QGZ7 A0A8I3RQJ9 LinkDB All DBs Position 1:20112167..20112692 Genome browser AA seq 136 aa AA seqDB search MARTKQTAHKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALHEIRHYQKSTE LLIRKFPFQRLVREIAQDFKTDLRFQSAATGALQEASEAYLVGLFEDTNLCAIHVKRVTI MPKDIQLARHIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcccacaaatcgacaggtggtaaagcaccgaggaagcaa ctggctacaaaagccgctcgcaagagtgcaccctctactggaggggtgaagaaacctcat cgttacaggcctggtactgtggcactccatgaaattagacactatcagaagtccactgaa cttctgatccgcaaatttcctttccagcgtctggtgcgagaaattgctcaggacttcaaa acagatctgcgcttccagagtgcagctactggtgctttgcaggaggcaagtgaggcctat ctggtgggcctctttgaagacaccaacctgtgtgctatccatgtcaaacgtgtcacaatt atgccaaaagacatccagctagcacgccacatacgtggagaacgtgcttaa

DBGET integrated database retrieval system