Chamaea fasciata (wrentit): 136291341 Help Entry 136291341         CDS       T11360                                  Symbol H2AZ1 Name (RefSeq) histone H2A.Z   KO K11251   histone H2A Organism cfai  Chamaea fasciata (wrentit) Pathway cfai03082   ATP-dependent chromatin remodeling cfai04217   Necroptosis Brite KEGG Orthology (KO) [BR:cfai00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     136291341 (H2AZ1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     136291341 (H2AZ1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cfai03036]     136291341 (H2AZ1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfai04147]     136291341 (H2AZ1) Chromosome and associated proteins [BR:cfai03036]  Eukaryotic type   Nucleosome assembly factors    Histones     136291341 (H2AZ1) Exosome [BR:cfai04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    136291341 (H2AZ1) BRITE hierarchy SSDB OrthologParalogGFIT Other DBs NCBI-GeneID:  136291341 NCBI-ProteinID:  XP_066042410 LinkDB All DBs Position Unknown AA seq 128 aa AA seqDB search MAGGKAGKDSGKTKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILE YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG KKGQQKTV NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggctggtgggaaagctgggaaagactccgggaagaccaagaccaaggcagtgtcccgt tcccaaagggctggattgcagttccctgttggccgcatccataggcacctgaagtctagg acaactagccatgggcgtgtaggagccacagctgctgtatatagtgctgcaatcctggag tacctgacagctgaggtccttgagctggcaggaaatgcatccaaagacttgaaggtgaaa cgcatcactccccgtcacctgcagcttgccattagaggagatgaagagctggattccctg atcaaggcaacaattgctggtggtggtgtaataccacatatccacaagtccctcattggc aagaaaggacaacagaagactgtctaa

DBGET integrated database retrieval system