Chamaea fasciata (wrentit): 136301148 Help Entry 136301148         CDS       T11360                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism cfai  Chamaea fasciata (wrentit) Pathway cfai04010   MAPK signaling pathway cfai04012   ErbB signaling pathway cfai04068   FoxO signaling pathway cfai04137   Mitophagy - animal cfai04140   Autophagy - animal cfai04150   mTOR signaling pathway cfai04210   Apoptosis cfai04218   Cellular senescence cfai04370   VEGF signaling pathway cfai04371   Apelin signaling pathway cfai04540   Gap junction cfai04625   C-type lectin receptor signaling pathway cfai04810   Regulation of actin cytoskeleton cfai04910   Insulin signaling pathway cfai04912   GnRH signaling pathway cfai04916   Melanogenesis Brite KEGG Orthology (KO) [BR:cfai00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     136301148 (NRAS)    04012 ErbB signaling pathway     136301148 (NRAS)    04370 VEGF signaling pathway     136301148 (NRAS)    04371 Apelin signaling pathway     136301148 (NRAS)    04068 FoxO signaling pathway     136301148 (NRAS)    04150 mTOR signaling pathway     136301148 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     136301148 (NRAS)    04137 Mitophagy - animal     136301148 (NRAS)   09143 Cell growth and death    04210 Apoptosis     136301148 (NRAS)    04218 Cellular senescence     136301148 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     136301148 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     136301148 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     136301148 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     136301148 (NRAS)    04912 GnRH signaling pathway     136301148 (NRAS)    04916 Melanogenesis     136301148 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cfai04131]     136301148 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfai04147]     136301148 (NRAS)    04031 GTP-binding proteins [BR:cfai04031]     136301148 (NRAS) Membrane trafficking [BR:cfai04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     136301148 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     136301148 (NRAS) Exosome [BR:cfai04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    136301148 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    136301148 (NRAS)   Exosomal proteins of breast cancer cells    136301148 (NRAS)   Exosomal proteins of colorectal cancer cells    136301148 (NRAS) GTP-binding proteins [BR:cfai04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     136301148 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 FeoB_N Septin Ldh_1_N ParA Motif Other DBs NCBI-GeneID:  136301148 NCBI-ProteinID:  XP_066060111 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSEDGNQG CMGLSCLVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagctggtggtggtgggcgccggcggcgtgggcaagagcgcgctgacc atccagctcatccagaaccacttcgtggacgagtacgaccccaccatcgaggactcgtac cgcaagcaggtggtgatcgatggcgagacgtgtctgctggacatcctggacacggcgggg caggaggagtacagcgccatgagggaccagtacatgaggacgggggagggattcctctgc gtcttcgccatcaacaacagcaaatccttcgccgacatcaacctctacagagagcagatc aagagggtgaaggactcggatgacgtgcccatggtgctggtggggaacaagtgtgatctg cccacgagaacagtggacacaaaacaggcccaagaactggcgaaaagctacggaatcccc ttcatagagacctctgcaaaaacgagacagggtgtggaagatgctttttacaccctggtg agagagatccggcagtaccggatgaagaagctcaacagcagcgaggatgggaaccagggc tgcatgggattgtcctgccttgtcatgtga

DBGET integrated database retrieval system