Citrobacter farmeri: CI104_01325 Help Entry CI104_01325       CDS       T05012                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cfar  Citrobacter farmeri Pathway cfar01100   Metabolic pathways cfar01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cfar00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CI104_01325    00074 Mycolic acid biosynthesis     CI104_01325   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CI104_01325 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AST77817 UniProt:  A0A8H9NZA3 LinkDB All DBs Position complement(274375..274632) Genome browser AA seq 85 aa AA seqDB search MQALYLEIKNLIITTLNLDELSTDDIETEAALFGDGLGLDSIDALELGLAVKNQYGVVLS AESEEMRQHFFSVATLASFINAQRA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgctttatcttgaaattaaaaatctcatcataacgacattgaatctggatgaa ctgtcgacagacgacattgaaaccgaggcggcgctgtttggcgacggcctggggctggac tcaattgatgccctggaattgggactggcggtaaaaaatcagtacggtgtggtgctttct gcggaaagcgaagagatgcgtcagcacttcttctccgtcgccacgctggcatcgttcatt aatgcgcaacgtgcctaa

DBGET integrated database retrieval system