Citrobacter farmeri: CI104_09965 Help Entry CI104_09965       CDS       T05012                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cfar  Citrobacter farmeri Pathway cfar01100   Metabolic pathways cfar01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cfar00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CI104_09965    00074 Mycolic acid biosynthesis     CI104_09965   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CI104_09965 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AST82245 UniProt:  A0A8H9TU18 LinkDB All DBs Position 2025259..2025519 Genome browser AA seq 86 aa AA seqDB search MINHKEVMDYTLHCLQGMVESGVDIHPDSDLVNDLGLESIHVMDLLMLLEDKFDISIPIN ILLDVKTPAQLMEALIPCLESLNASL NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgataaatcataaagaagtaatggattacactcttcactgtttacaggggatggtcgaa agcggtgtggatattcatcctgatagcgacctggttaatgatcttggactggaatcaatt cacgttatggatctattaatgttgttggaagataaattcgatatttctatccctattaac attttgttggatgtaaaaacgccggctcaattaatggaagcgttaatcccctgtctggag agtctcaatgcgtctttatga

DBGET integrated database retrieval system