Clostridium felsineum DSM 794: CLFE_022170 Help Entry CLFE_022170       CDS       T08216                                  Symbol acpP_4 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism cfb  Clostridium felsineum DSM 794 Pathway cfb01100   Metabolic pathways cfb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cfb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CLFE_022170 (acpP_4)    00074 Mycolic acid biosynthesis     CLFE_022170 (acpP_4)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CLFE_022170 (acpP_4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  URZ16170 LinkDB All DBs Position 2339144..2339377 Genome browser AA seq 77 aa AA seqDB search MIFEKVKDVIADQLGIDASEIKMESSFIDDLGADSLDIVELIMALEEEFDIEMPDEEAEK VSSVGDVVNYIKAHTEE NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgatatttgaaaaagttaaagacgtgatagcagatcaacttggaatagacgcatctgaa attaaaatggaatcctcttttattgatgatttaggagcagattctcttgatatagtcgaa ttaataatggctttagaagaagaatttgatatagagatgcctgatgaagaagctgaaaaa gtttcaagtgtaggagacgtagttaattacataaaggctcatacagaagagtaa

DBGET integrated database retrieval system