Ctenocephalides felis (cat flea): 113367786 Help Entry 113367786         CDS       T08578                                  Name (RefSeq) cdc42 homolog   KO K04393   cell division control protein 42 Organism cfel  Ctenocephalides felis (cat flea) Pathway cfel04144   Endocytosis cfel05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:cfel00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     113367786  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     113367786  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cfel04131]     113367786    03036 Chromosome and associated proteins [BR:cfel03036]     113367786   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfel04147]     113367786    04031 GTP-binding proteins [BR:cfel04031]     113367786 Membrane trafficking [BR:cfel04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     113367786  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     113367786   Macropinocytosis    Ras GTPases     113367786 Chromosome and associated proteins [BR:cfel03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     113367786 Exosome [BR:cfel04147]  Exosomal proteins   Exosomal proteins of microglial cells    113367786   Exosomal proteins of breast milk    113367786 GTP-binding proteins [BR:cfel04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     113367786 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  113367786 NCBI-ProteinID:  XP_026465151 LinkDB All DBs Position Unknown AA seq 167 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCQKTPFLLVGTQIDLR DDAATMEKLAKNKQKPIGLEQGEKLAKELKAVKYVECSALTQVKDNR NT seq 504 nt NT seq  +upstreamnt  +downstreamnt atgcagactattaaatgtgtggttgtgggtgacggagcggtgggtaaaacttgccttcta atcagttatacaacgaataaattcccatcggaatatgtgccaacagtattcgataactat gcagtcactgtcatgattggtggagaaccttacacgttgggtctattcgatacagcaggt caagaagattatgatagattacgaccactcagttacccgcagacggatgtatttttagtt tgtttctcagtcgttagtccaagttcatttgaaaatgttaaagaaaagtgggtccccgaa ataacgcaccactgtcagaagacgccgttcctgctggtcggcacgcagatcgatctgcgc gacgacgcggcgacgatggagaaactggccaagaacaaacagaaaccgatcgggttggag cagggcgagaagctcgccaaggaactcaaagcggtcaaatacgtcgagtgctcggcgctg acacaggtaaaggataatagatag

DBGET integrated database retrieval system