Ctenocephalides felis (cat flea): 113373235 Help Entry 113373235         CDS       T08578                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism cfel  Ctenocephalides felis (cat flea) Pathway cfel04013   MAPK signaling pathway - fly cfel04145   Phagosome cfel04148   Efferocytosis cfel04310   Wnt signaling pathway cfel04517   IgSF CAM signaling cfel04518   Integrin signaling cfel04620   Toll-like receptor signaling pathway cfel05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:cfel00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     113373235    04310 Wnt signaling pathway     113373235   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     113373235    04518 Integrin signaling     113373235  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     113373235    04148 Efferocytosis     113373235  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     113373235  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     113373235  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cfel04131]     113373235   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfel04147]     113373235    04031 GTP-binding proteins [BR:cfel04031]     113373235 Membrane trafficking [BR:cfel04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     113373235  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     113373235   Macropinocytosis    Ras GTPases     113373235  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     113373235 Exosome [BR:cfel04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113373235   Exosomal proteins of other body fluids (saliva and urine)    113373235   Exosomal proteins of colorectal cancer cells    113373235   Exosomal proteins of bladder cancer cells    113373235 GTP-binding proteins [BR:cfel04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     113373235 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD Motif Other DBs NCBI-GeneID:  113373235 NCBI-ProteinID:  XP_026469323 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR EDKDTVEKLKDKKLAPITYPQGLSMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPV LPVKPKRKCVLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaagctataaagtgtgtcgtcgtgggagacggagccgtcggtaagacatgtttgctg atcagttacacaacaaatgcctttcctggcgaatacatacccacagtatttgacaactac tctgccaatgttatggtcgatggtaaaccgatcaatttgggattatgggatacagcaggt caagaagattacgaccgtctcaggccactttcctaccctcagactgacgtattcctgatt tgtttttcactggtgaatccagcatcattcgagaacgtacgcgccaaatggtatccagaa gtgcggcaccattgcccgaacacgccgataatactcgtcggaacgaagctcgatttgcgc gaagacaaggacactgtcgaaaagttaaaggataaaaaattagcacctattacatatcca caaggcctgtcgatggcaaaagaaataggcgctgttaaatatctagaatgttcagcgctc acgcagaaaggactaaaaacagttttcgatgaagcgatacgggctgtcctttgcccggtg cttccggttaaaccgaaaagaaaatgcgttttgctctag

DBGET integrated database retrieval system