Ctenocephalides felis (cat flea): 113373235 Help Entry 113373235         CDS       T08578                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism cfel  Ctenocephalides felis (cat flea) Pathway cfel04013   MAPK signaling pathway - fly cfel04145   Phagosome cfel04148   Efferocytosis cfel04310   Wnt signaling pathway cfel04620   Toll-like receptor signaling pathway cfel05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:cfel00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     113373235    04310 Wnt signaling pathway     113373235  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     113373235    04148 Efferocytosis     113373235  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     113373235  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     113373235  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cfel04131]     113373235   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfel04147]     113373235    04031 GTP-binding proteins [BR:cfel04031]     113373235 Membrane trafficking [BR:cfel04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     113373235  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     113373235   Macropinocytosis    Ras GTPases     113373235  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     113373235 Exosome [BR:cfel04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113373235   Exosomal proteins of other body fluids (saliva and urine)    113373235   Exosomal proteins of colorectal cancer cells    113373235   Exosomal proteins of bladder cancer cells    113373235 GTP-binding proteins [BR:cfel04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     113373235 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD Motif Other DBs NCBI-GeneID:  113373235 NCBI-ProteinID:  XP_026469323 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR EDKDTVEKLKDKKLAPITYPQGLSMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPV LPVKPKRKCVLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaagctataaagtgtgtcgtcgtgggagacggagccgtcggtaagacatgtttgctg atcagttacacaacaaatgcctttcctggcgaatacatacccacagtatttgacaactac tctgccaatgttatggtcgatggtaaaccgatcaatttgggattatgggatacagcaggt caagaagattacgaccgtctcaggccactttcctaccctcagactgacgtattcctgatt tgtttttcactggtgaatccagcatcattcgagaacgtacgcgccaaatggtatccagaa gtgcggcaccattgcccgaacacgccgataatactcgtcggaacgaagctcgatttgcgc gaagacaaggacactgtcgaaaagttaaaggataaaaaattagcacctattacatatcca caaggcctgtcgatggcaaaagaaataggcgctgttaaatatctagaatgttcagcgctc acgcagaaaggactaaaaacagttttcgatgaagcgatacgggctgtcctttgcccggtg cttccggttaaaccgaaaagaaaatgcgttttgctctag

DBGET integrated database retrieval system