Ctenocephalides felis (cat flea): 113381022 Help Entry 113381022         CDS       T08578                                  Name (RefSeq) histone H2B-like   KO K11252   histone H2B Organism cfel  Ctenocephalides felis (cat flea) Brite KEGG Orthology (KO) [BR:cfel00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cfel03036]     113381022   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfel04147]     113381022 Chromosome and associated proteins [BR:cfel03036]  Eukaryotic type   Nucleosome assembly factors    Histones     113381022 Exosome [BR:cfel04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113381022 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF DUF5824 Motif Other DBs NCBI-GeneID:  113381022 NCBI-ProteinID:  XP_026475806 LinkDB All DBs Position Unknown AA seq 88 aa AA seqDB search MPPKTKRLKRLRKQAKPKNISKGDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIM NSFVNDIFERIAAEASRLGSLQQTLYNH NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgccaccgaaaaccaagcggttaaagcggctaagaaagcaggcaaagcccaaaaatatt tcaaagggcgacaagaagaagaaacgtaagcgcaaggagagctatgccatttatatttac aaagtcttgaaacaagtccatcctgacacgggcatttcgagcaaggcgatgagcatcatg aacagctttgtgaatgatatcttcgagcgtatagcggccgaggcatcgcgtttgggctca ctacaacaaacgctctacaatcactag

DBGET integrated database retrieval system