Ctenocephalides felis (cat flea): 113381818 Help Entry 113381818         CDS       T08578                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism cfel  Ctenocephalides felis (cat flea) Pathway cfel04070   Phosphatidylinositol signaling system cfel04745   Phototransduction - fly Brite KEGG Orthology (KO) [BR:cfel00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     113381818  09150 Organismal Systems   09157 Sensory system    04745 Phototransduction - fly     113381818  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:cfel01009]     113381818   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cfel04131]     113381818    03036 Chromosome and associated proteins [BR:cfel03036]     113381818   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfel04147]     113381818 Protein phosphatases and associated proteins [BR:cfel01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      113381818 Membrane trafficking [BR:cfel04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     113381818 Chromosome and associated proteins [BR:cfel03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      113381818 Exosome [BR:cfel04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    113381818 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_6 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_8 EF-hand_9 AIF-1 FCaBP_EF-hand SAP Htt_N-HEAT_1 FDX-ACB DHH Motif Other DBs NCBI-GeneID:  113381818 NCBI-ProteinID:  XP_026476279 LinkDB All DBs Position Unknown AA seq 141 aa AA seqDB search MASTRPHRENMTDEQIAEFREAFALYDKDGDGAISAAELGTVMRALGQTPSEAELKGYVK DNSVAMTVDFPTFLTMMARQMQEGSSVDEIREAFRVFDKDGNGRMSVAELRHILTSLGER LTDNEVDAMIREFIQAMTMSS NT seq 426 nt NT seq  +upstreamnt  +downstreamnt atggcaagcacaagaccccacagggagaacatgacagacgaacagattgcagaattccgt gaagcttttgctttgtacgacaaagacggagatggtgcgatatcagccgccgaattagga actgtcatgagggctttgggtcaaactccttccgaagccgaacttaaaggatacgtcaag gataatagcgtggccatgaccgtagattttccaacatttttgacaatgatggctcgtcag atgcaggaaggcagcagtgttgatgaaatccgggaagccttccgggtttttgataaagat ggtaatggccgaatgtctgttgcggaattgagacacattttaacatctcttggagaacgc ttaacagataatgaggtggacgcaatgatccgagaatttattcaagcaatgacgatgagt tcataa

DBGET integrated database retrieval system